Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

MLKL Rabbit pAb (A13451)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - MLKL Rabbit pAb (A13451)

Western blot analysis of extracts of various cell lines, using MLKL antibody (A13451) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Western blot analysis of extracts of Mouse liver, using MLKL antibody (A13451) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of extracts of Rat testis, using MLKL antibody (A13451) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

You may also interested in:

Overview

Product name	MLKL Rabbit pAb
Catalog No.	A13451
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene belongs to the protein kinase superfamily. The encoded protein contains a protein kinase-like domain; however, is thought to lack protein kinase activity. This protein plays a critical role in tumor necrosis factor (TNF)-induced necroptosis, a programmed cell death process, via interaction with receptor-interacting protein 3 (Rip3), which is a key signaling molecule in necroptosis pathway. Knockout of this gene in mice showed that it is essential for necroptosis. Alternatively spliced transcript variants have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-62 of mouse MLKL (Q9D2Y4).
Sequence	MDKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAALG
Gene ID	74568
Swiss prot	Q9D2Y4
Synonyms	9130019I15Rik
Calculated MW	54kDa
Observed MW	54kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key	Western blotting Immunohistochemistry
Positive samples	Jurkat, NCI-H460, Mouse liver, Rat testis
Cellular location	Cell membrane, Cytoplasm
Customer validation	WB，IF(Rattus norvegicus) WB(Homo sapiens)

MLKL Rabbit pAb images

Western blot - MLKL Rabbit pAb (A13451)

Product Protocols

Inquire About This Product

Submit your question about A13451 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on Mlkl. (Numbers indicate number of published articles where both targets appear.)

◀1/▶

Related Research Area

Based on existing publications, the following research topics are related to Mlkl. (Distance between topics and target gene indicate popularity.) Mlkl

* Data provided by citexs.com, for reference only.