Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

MLKL Rabbit pAb (A13451)

Publications (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - MLKL Rabbit pAb (A13451)

Western blot analysis of various lysates using MLKL Rabbit pAb (A13451) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Western blot - MLKL Rabbit pAb (A13451)

Western blot analysis of lysates from Mouse liver, using MLKL Rabbit pAb (A13451) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - MLKL Rabbit pAb (A13451)

Western blot analysis of lysates from Rat testis, using MLKL Rabbit pAb (A13451) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

You may also interested in:

Overview

Product name MLKL Rabbit pAb
Catalog No. A13451
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene belongs to the protein kinase superfamily. The encoded protein contains a protein kinase-like domain; however, is thought to lack protein kinase activity. This protein plays a critical role in tumor necrosis factor (TNF)-induced necroptosis, a programmed cell death process, via interaction with receptor-interacting protein 3 (Rip3), which is a key signaling molecule in necroptosis pathway. Knockout of this gene in mice showed that it is essential for necroptosis. Alternatively spliced transcript variants have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-62 of mouse MLKL (Q9D2Y4).
Sequence MDKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAALG
Gene ID 74568
Swiss prot Q9D2Y4
Synonyms 9130019I15Rik; MLKL
Calculated MW 54kDa
Observed MW 54kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Jurkat, NCI-H460, Mouse liver, Rat testis
Cellular location Cell membrane, Cytoplasm
Customer validation

WB (Homo sapiens, Rattus norvegicus)

IF (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

MLKL Rabbit pAb images

ABclonal:Western blot - MLKL Rabbit pAb (A13451)}

Western blot - MLKL Rabbit pAb (A13451)

Western blot analysis of various lysates using MLKL Rabbit pAb (A13451) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Western blot - MLKL Rabbit pAb (A13451)}

Western blot - MLKL Rabbit pAb (A13451)

Western blot analysis of lysates from Mouse liver, using MLKL Rabbit pAb (A13451) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - MLKL Rabbit pAb (A13451)}

Western blot - MLKL Rabbit pAb (A13451)

Western blot analysis of lysates from Rat testis, using MLKL Rabbit pAb (A13451) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Inquire About This Product

Submit your question about A13451 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on Mlkl. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to Mlkl. (Distance between topics and target gene indicate popularity.) Mlkl

* Data provided by citexs.com, for reference only.

Publishing research using A13451? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order