Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

[KO Validated] LC3B Rabbit mAb (A19665)

KO/KDValidated

Reviews (3) Publications (96) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] LC3B Rabbit mAb (A19665)

Western blot analysis of various lysates, using [KO Validated] LC3B Rabbit mAb (A19665) at 1:1000 dilution.293T, C6 and NIH/3T3 cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Western blot - [KO Validated] LC3B Rabbit mAb (A19665)

Western blot analysis of lysates from wild type(WT) and LKB1 knockout (KO) 293T cells, using [KO Validated] LC3B Rabbit mAb (A19665) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - [KO Validated] LC3B Rabbit mAb (A19665)

Immunohistochemistry analysis of LC3B in paraffin-embedded human brain using [KO Validated] LC3B Rabbit mAb (A19665) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - [KO Validated] LC3B Rabbit mAb (A19665)

Immunohistochemistry analysis of LC3B in paraffin-embedded rat brain using [KO Validated] LC3B Rabbit mAb (A19665) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - [KO Validated] LC3B Rabbit mAb (A19665)

Confocal imaging of HeLa cells (treated with chloroquine) and HeLa cells (untreated) using [KO Validated] LC3B Rabbit mAb (A19665, dilution 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 100x.

ABclonal:Immunoprecipitation - [KO Validated] LC3B Rabbit mAb (A19665)

Immunoprecipitation analysis of 300 μg extracts from 293T cells using 3 μg LC3B antibody (A19665). Western blot was performed from the immunoprecipitate using LC3B antibody (A19665) at a dilution of 1:1000.

Review
ABclonal: review for [KO Validated] LC3B Rabbit mAb(A19665)
Review
ABclonal: review for [KO Validated] LC3B Rabbit mAb(A19665)
Review
ABclonal: review for [KO Validated] LC3B Rabbit mAb(A19665)

You may also interested in:

Overview

Product name [KO Validated] LC3B Rabbit mAb
Catalog No. A19665
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0144

Background

The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 2-107 of human LC3B (Q9GZQ8).
Sequence PSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDG
Gene ID 81631
Swiss prot Q9GZQ8
Synonyms LC3B; ATG8F; MAP1LC3B-a; MAP1A/1BLC3; 3B
Calculated MW 15kDa
Observed MW 14kDa/16kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IF/ICC HumanMouse
WB HumanMouseRat
IHC-P HumanRat
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples 293T, C6, NIH/3T3
Cellular location Cytoplasm, Cytoplasmic vesicle, Endomembrane system, Lipid-anchor, autophagosome, autophagosome membrane, cytoskeleton
Customer validation

(Hela, Chicken)

WB (Mus musculus, Homo sapiens, Rattus norvegicus, Gallus gallus, Human, Sus scrofa, Ctenopharyngodon idellus)

IF (Homo sapiens, Gallus gallus, Mus musculus, Rattus norvegicus)

IHC (Mus musculus, Homo sapiens, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] LC3B Rabbit mAb images

ABclonal:Western blot - [KO Validated] LC3B Rabbit mAb (A19665)}

Western blot - [KO Validated] LC3B Rabbit mAb (A19665)

Western blot analysis of various lysates, using [KO Validated] LC3B Rabbit mAb (A19665) at 1:1000 dilution.293T, C6 and NIH/3T3 cells were treated by Chloroquine (50 μM) at 37℃ for 20 hours.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Western blot - [KO Validated] LC3B Rabbit mAb (A19665)}

Western blot - [KO Validated] LC3B Rabbit mAb (A19665)

Western blot analysis of lysates from wild type(WT) and LKB1 knockout (KO) 293T cells, using [KO Validated] LC3B Rabbit mAb (A19665) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - [KO Validated] LC3B Rabbit mAb (A19665)}

Immunohistochemistry - [KO Validated] LC3B Rabbit mAb (A19665)

Immunohistochemistry analysis of LC3B in paraffin-embedded human brain using [KO Validated] LC3B Rabbit mAb (A19665) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KO Validated] LC3B Rabbit mAb (A19665)}

Immunohistochemistry - [KO Validated] LC3B Rabbit mAb (A19665)

Immunohistochemistry analysis of LC3B in paraffin-embedded rat brain using [KO Validated] LC3B Rabbit mAb (A19665) at dilution of 1:100(40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - [KO Validated] LC3B Rabbit mAb (A19665)}

Immunofluorescence - [KO Validated] LC3B Rabbit mAb (A19665)

Confocal imaging of HeLa cells (treated with chloroquine) and HeLa cells (untreated) using [KO Validated] LC3B Rabbit mAb (A19665, dilution 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 100x.
ABclonal:Immunoprecipitation - [KO Validated] LC3B Rabbit mAb (A19665)}

Immunoprecipitation - [KO Validated] LC3B Rabbit mAb (A19665)

Immunoprecipitation analysis of 300 μg extracts from 293T cells using 3 μg LC3B antibody (A19665). Western blot was performed from the immunoprecipitate using LC3B antibody (A19665) at a dilution of 1:1000.

Submit an review for A19665

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A19665 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MAP1LC3B. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MAP1LC3B. (Distance between topics and target gene indicate popularity.) MAP1LC3B

* Data provided by citexs.com, for reference only.

Publishing research using A19665? Please let us know so that we can cite the reference in this datasheet.

Antibodies (10)

ELISA Kits (1)

Secondary Antibodies (22)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order