Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

KDM1 Rabbit pAb (A1156)

Publications (4) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - KDM1 Rabbit pAb (A1156)

Western blot analysis of lysates from MCF7 cells, using KDM1 Rabbit pAb (A1156) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).

ABclonal:Immunoprecipitation - KDM1 Rabbit pAb (A1156)

Immunoprecipitation analysis of 200 μg extracts of HeLa cells using 3 μg KDM1 antibody (A1156). Western blot was performed from the immunoprecipitate using KDM1 antibody (A1156) at a dilution of 1:500.

You may also interested in:

Overview

Product name KDM1 Rabbit pAb
Catalog No. A1156
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a nuclear protein containing a SWIRM domain, a FAD-binding motif, and an amine oxidase domain. This protein is a component of several histone deacetylase complexes, though it silences genes by functioning as a histone demethylase. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 365-515 of human KDM1 (NP_055828.2).
Sequence ANGQAVPKEKDEMVEQEFNRLLEATSYLSHQLDFNVLNNKPVSLGQALEVVIQLQEKHVKDEQIEHWKKIVKTQEELKELLNKMVNLKEKIKELHQQYKEASEVKPPRDITAEFLVKSKHRDLTALCKEYDELAETQGKLEEKLQELEANP
Gene ID 23028
Swiss prot O60341
Synonyms AOF2; CPRF; KDM1; LSD1; BHC110
Calculated MW 93kDa
Observed MW 117kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunoprecipitation    
Positive samples MCF7, 293T
Cellular location Nucleus
Customer validation

WB (Mus musculus, Homo sapiens)

IP (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

KDM1 Rabbit pAb images

ABclonal:Western blot - KDM1 Rabbit pAb (A1156)}

Western blot - KDM1 Rabbit pAb (A1156)

Western blot analysis of lysates from MCF7 cells, using KDM1 Rabbit pAb (A1156) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
ABclonal:Immunoprecipitation - KDM1 Rabbit pAb (A1156)}

Immunoprecipitation - KDM1 Rabbit pAb (A1156)

Immunoprecipitation analysis of 200 μg extracts of HeLa cells using 3 μg KDM1 antibody (A1156). Western blot was performed from the immunoprecipitate using KDM1 antibody (A1156) at a dilution of 1:500.

Inquire About This Product

Submit your question about A1156 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KDM1A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KDM1A. (Distance between topics and target gene indicate popularity.) KDM1A

* Data provided by citexs.com, for reference only.

Publishing research using A1156? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order