Tested applications:WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Human, Mouse
Product name | [KO Validated] Insulin-degrading enzyme (IDE) Rabbit pAb |
---|---|
Catalog No. | A1630 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human Insulin-degrading enzyme (Insulin-degrading enzyme (IDE)) (NP_004960.2). |
---|---|
Sequence | MRYRLAWLLHPALPSTFRSVLGARLPPPERLCGFQKKTYSKMNNPAIKRIGNHITKSPEDKREYRGLELANGIKVLLISDPTTDKSSAALDVHIGSLSDPPNIAGLSHFCEHMLFLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNYYFDVSHEHLEGALDRFAQFFLCPLFDESCKDREVNAVDSEHEKNVMNDAWRLFQLEKATGNPKHPFSKFGTGNKYTLETRPNQEGIDVRQELLKFHSAYYS |
Gene ID | 3416 |
Swiss prot | P14735 |
Synonyms | IDE; INSULYSIN |
Calculated MW | 54kDa/117kDa |
Observed MW | 118kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunofluorescence |
Positive samples | DU145, Mouse liver |
Cellular location | Cell membrane, Cytoplasm, Secreted |
Customer validation | WB(Mus musculus) |
Submit your question about A1630 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A1630? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.