Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

[KO Validated] IRF3 Rabbit mAb (A19717)

KO/KDValidated

Review (1) Publications (10) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - [KO Validated] IRF3 Rabbit mAb (A19717)

Western blot analysis of lysates from wild type (WT) and IRF3 knockout (KO) HeLa cells, using [KO Validated] IRF3 Rabbit mAb (A19717) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Western blot - [KO Validated] IRF3 Rabbit mAb (A19717)

Western blot analysis of various lysates using [KO Validated] IRF3 Rabbit mAb (A19717) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Review
ABclonal: review for [KO Validated] IRF3 Rabbit mAb(A19717)

You may also interested in:

Overview

Product name [KO Validated] IRF3 Rabbit mAb
Catalog No. A19717
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0198

Background

This gene encodes a member of the interferon regulatory transcription factor (IRF) family. The encoded protein is found in an inactive cytoplasmic form that upon serine/threonine phosphorylation forms a complex with CREBBP. This complex translocates to the nucleus and activates the transcription of interferons alpha and beta, as well as other interferon-induced genes. The protein plays an important role in the innate immune response against DNA and RNA viruses. Mutations in this gene are associated with Encephalopathy, acute, infection-induced, herpes-specific, 7.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IRF3 (Q14653).
Sequence DFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLA
Gene ID 3661
Swiss prot Q14653
Synonyms IIAE7; F3
Calculated MW 47kDa
Observed MW 57kDa

Applications

Reactivity Human, Mouse
Tested applications Testing results
WB HumanMouse
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Jurkat, 293T, HeLa
Cellular location Cytoplasm, Nucleus
Customer validation

(T47D、HeLa、 U2-OS、 PC-3、 RPMI-Q26、 MOLT4、 293T)

WB (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] IRF3 Rabbit mAb images

ABclonal:Western blot - [KO Validated] IRF3 Rabbit mAb (A19717)}

Western blot - [KO Validated] IRF3 Rabbit mAb (A19717)

Western blot analysis of lysates from wild type (WT) and IRF3 knockout (KO) HeLa cells, using [KO Validated] IRF3 Rabbit mAb (A19717) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
ABclonal:Western blot - [KO Validated] IRF3 Rabbit mAb (A19717)}

Western blot - [KO Validated] IRF3 Rabbit mAb (A19717)

Western blot analysis of various lysates using [KO Validated] IRF3 Rabbit mAb (A19717) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Submit an review for A19717

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A19717 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on IRF3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to IRF3. (Distance between topics and target gene indicate popularity.) IRF3

* Data provided by citexs.com, for reference only.

Publishing research using A19717? Please let us know so that we can cite the reference in this datasheet.

Antibodies (6)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order