Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KD Validated] IGF1R Rabbit pAb (A0243)

Publications (7) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KD Validated] IGF1R Rabbit pAb (A0243)

Western blot analysis of lysates from wild type (WT) and IGF1R knockdown (KD) 293T cells using [KD Validated] IGF1R Rabbit pAb (A0243) at 1:3000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - [KD Validated] IGF1R Rabbit pAb (A0243)

Western blot analysis of various lysates using [KD Validated] IGF1R Rabbit pAb (A0243) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

You may also interested in:

Overview

Product name [KD Validated] IGF1R Rabbit pAb
Catalog No. A0243
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1201-1367 of human IGF1R (NP_000866.1).
Sequence VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFLEIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
Gene ID 3480
Swiss prot P08069
Synonyms IGFR; CD221; IGFIR; JTK13; 1R
Calculated MW 155kDa
Observed MW 100kDa/

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples 293T, HeLa, A375
Cellular location Cell membrane, Single-pass type I membrane protein
Customer validation

WB (Homo sapiens, Mus musculus)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KD Validated] IGF1R Rabbit pAb images

ABclonal:Western blot - [KD Validated] IGF1R Rabbit pAb (A0243)}

Western blot - [KD Validated] IGF1R Rabbit pAb (A0243)

Western blot analysis of lysates from wild type (WT) and IGF1R knockdown (KD) 293T cells using [KD Validated] IGF1R Rabbit pAb (A0243) at 1:3000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - [KD Validated] IGF1R Rabbit pAb (A0243)}

Western blot - [KD Validated] IGF1R Rabbit pAb (A0243)

Western blot analysis of various lysates using [KD Validated] IGF1R Rabbit pAb (A0243) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Inquire About This Product

Submit your question about A0243 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on IGF1R. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to IGF1R. (Distance between topics and target gene indicate popularity.) IGF1R

* Data provided by citexs.com, for reference only.

Publishing research using A0243? Please let us know so that we can cite the reference in this datasheet.

Antibodies (5)

ELISA Kits (1)

Proteins (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order