Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] IFITM3 Rabbit pAb (A13070)

KO/KDValidated

Publications (2) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] IFITM3 Rabbit pAb (A13070)

Western blot analysis of lysates from HeLa cells, using [KO Validated] IFITM3 Rabbit pAb (A13070) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Western blot - [KO Validated] IFITM3 Rabbit pAb (A13070)

Western blot analysis of lysates from wild type (WT) and IFITM3 knockout (KO) HeLa cells, using [KO Validated] IFITM3 Rabbit pAb (A13070) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - [KO Validated] IFITM3 Rabbit pAb (A13070)

Immunohistochemistry analysis of IFITM3 in paraffin-embedded Human colon carcinoma using [KO Validated] IFITM3 Rabbit pAb (A13070) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - [KO Validated] IFITM3 Rabbit pAb (A13070)

Immunofluorescence analysis of C6 cells using [KO Validated] IFITM3 Rabbit pAb (A13070) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - [KO Validated] IFITM3 Rabbit pAb (A13070)

Immunofluorescence analysis of L929 cells using [KO Validated] IFITM3 Rabbit pAb (A13070) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - [KO Validated] IFITM3 Rabbit pAb (A13070)

Immunofluorescence analysis of U-2 OS cells using [KO Validated] IFITM3 Rabbit pAb (A13070) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name [KO Validated] IFITM3 Rabbit pAb
Catalog No. A13070
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Interferon-induced transmembrane (IFITM) proteins are a family of interferon induced antiviral proteins. The family contains five members, including IFITM1, IFITM2 and IFITM3 and belong to the CD225 superfamily. The protein encoded by this gene restricts cellular entry by diverse viral pathogens, such as influenza A virus, Ebola virus and Sars-CoV-2.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-133 of human IFITM3 (NP_066362.2).
Sequence MNHTVQTFFSPVNSGQPPNYEMLKEEHEVAVLGAPHNPAPPTSTVIHIRSETSVPDHVVWSLFNTLFMNPCCLGFIAFAYSVKSRDRKMVGDVTGAQAYASTAKCLNIWALILGILMTILLIVIPVLIFQAYG
Gene ID 10410
Swiss prot Q01628
Synonyms 1-8U; IP15; DSPA2b; M3
Calculated MW 15kDa
Observed MW 15kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:100
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa
Cellular location Cell membrane, Late endosome membrane, Lysosome membrane, Single-pass type II membrane protein
Customer validation

WB (Homo sapiens)

WB IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] IFITM3 Rabbit pAb images

ABclonal:Western blot - [KO Validated] IFITM3 Rabbit pAb (A13070)}

Western blot - [KO Validated] IFITM3 Rabbit pAb (A13070)

Western blot analysis of lysates from HeLa cells, using [KO Validated] IFITM3 Rabbit pAb (A13070) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Western blot - [KO Validated] IFITM3 Rabbit pAb (A13070)}

Western blot - [KO Validated] IFITM3 Rabbit pAb (A13070)

Western blot analysis of lysates from wild type (WT) and IFITM3 knockout (KO) HeLa cells, using [KO Validated] IFITM3 Rabbit pAb (A13070) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - [KO Validated] IFITM3 Rabbit pAb (A13070)}

Immunohistochemistry - [KO Validated] IFITM3 Rabbit pAb (A13070)

Immunohistochemistry analysis of IFITM3 in paraffin-embedded Human colon carcinoma using [KO Validated] IFITM3 Rabbit pAb (A13070) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - [KO Validated] IFITM3 Rabbit pAb (A13070)}

Immunofluorescence - [KO Validated] IFITM3 Rabbit pAb (A13070)

Immunofluorescence analysis of C6 cells using [KO Validated] IFITM3 Rabbit pAb (A13070) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - [KO Validated] IFITM3 Rabbit pAb (A13070)}

Immunofluorescence - [KO Validated] IFITM3 Rabbit pAb (A13070)

Immunofluorescence analysis of L929 cells using [KO Validated] IFITM3 Rabbit pAb (A13070) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - [KO Validated] IFITM3 Rabbit pAb (A13070)}

Immunofluorescence - [KO Validated] IFITM3 Rabbit pAb (A13070)

Immunofluorescence analysis of U-2 OS cells using [KO Validated] IFITM3 Rabbit pAb (A13070) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A13070 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on IFITM3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to IFITM3. (Distance between topics and target gene indicate popularity.) IFITM3

* Data provided by citexs.com, for reference only.

Publishing research using A13070? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Antibodies (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order