Product name | [KO Validated] HSPB1 Rabbit pAb |
---|---|
Catalog No. | A16332 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human HSPB1 (NP_001531.1). |
---|---|
Sequence | MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEI |
Gene ID | 3315 |
Swiss prot | P04792 |
Synonyms | HSPB1; CMT2F; HEL-S-102; HMN2B; HS.76067; HSP27; HSP28; Hsp25; SRP27 |
Calculated MW | 22kDa |
Observed MW | 27KDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | HeLa |
Cellular location | Cytoplasm, Nucleus, cytoskeleton, spindle |
Submit your question about A16332 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.