Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248)

KO/KDValidated

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248)

Western blot analysis of various lysates using [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Western blot - [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248)

Western blot analysis of lysates from wild type (WT) and HP1 gamma/HP1 gamma/CBX3 knockout (KO) 293T cells, using [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248)

Immunofluorescence analysis of C6 cells using [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248)

Immunofluorescence analysis of U-2 OS cells using [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg HP1 gamma/CBX3 antibody (A2248). Western blot was performed from the immunoprecipitate using HP1 gamma/CBX3 antibody (A2248) at a dilution of 1:1000.

You may also interested in:

Overview

Product name [KO Validated] HP1 gamma/CBX3 Rabbit pAb
Catalog No. A2248
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

At the nuclear envelope, the nuclear lamina and heterochromatin are adjacent to the inner nuclear membrane. The protein encoded by this gene binds DNA and is a component of heterochromatin. This protein also can bind lamin B receptor, an integral membrane protein found in the inner nuclear membrane. The dual binding functions of the encoded protein may explain the association of heterochromatin with the inner nuclear membrane. This protein binds histone H3 tails methylated at Lys-9 sites. This protein is also recruited to sites of ultraviolet-induced DNA damage and double-strand breaks. Two transcript variants encoding the same protein but differing in the 5' UTR, have been found for this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-183 of human HP1 gamma/HP1 gamma/CBX3 (NP_009207.2).
Sequence MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ
Gene ID 11335
Swiss prot Q13185
Synonyms HECH; HP1-GAMMA; HP1Hs-gamma; X3
Calculated MW 21kDa
Observed MW 23kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples HeLa, MCF-7, 293T, A-549, NCI-H460, Mouse brain, Mouse lung, Mouse spleen
Cellular location Nucleus
Customer validation

WB (Mus musculus, Rattus norvegicus)

IHC (Mus musculus, Rattus norvegicus)

IF (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] HP1 gamma/CBX3 Rabbit pAb images

ABclonal:Western blot - [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248)}

Western blot - [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248)

Western blot analysis of various lysates using [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
ABclonal:Western blot - [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248)}

Western blot - [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248)

Western blot analysis of lysates from wild type (WT) and HP1 gamma/HP1 gamma/CBX3 knockout (KO) 293T cells, using [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunofluorescence - [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248)}

Immunofluorescence - [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248)

Immunofluorescence analysis of C6 cells using [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248)}

Immunofluorescence - [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248)

Immunofluorescence analysis of U-2 OS cells using [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248)}

Immunoprecipitation - [KO Validated] HP1 gamma/CBX3 Rabbit pAb (A2248)

Immunoprecipitation analysis of 300 μg extracts of HeLa cells using 3 μg HP1 gamma/CBX3 antibody (A2248). Western blot was performed from the immunoprecipitate using HP1 gamma/CBX3 antibody (A2248) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A2248 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CBX3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CBX3. (Distance between topics and target gene indicate popularity.) CBX3

* Data provided by citexs.com, for reference only.

Publishing research using A2248? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order