Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] HNRNPA2B1 Rabbit pAb (A1162)

KO/KDValidated

Review (1) Publications (6) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] HNRNPA2B1 Rabbit pAb (A1162)

Western blot analysis of lysates from wild type (WT) and HNRNPA2B1 knockout (KO) 293T cells, using [KO Validated] HNRNPA2B1 Rabbit pAb (A1162) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - [KO Validated] HNRNPA2B1 Rabbit pAb (A1162)

Western blot analysis of various lysates, using [KO Validated] HNRNPA2B1 Rabbit pAb (A1162) at 1:3500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - [KO Validated] HNRNPA2B1 Rabbit pAb (A1162)

Immunohistochemistry analysis of HNRNPA2B1 in paraffin-embedded rat lung tissue using [KO Validated] HNRNPA2B1 Rabbit pAb (A1162) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - [KO Validated] HNRNPA2B1 Rabbit pAb (A1162)

Immunohistochemistry analysis of HNRNPA2B1 in paraffin-embedded human cervix tissue using [KO Validated] HNRNPA2B1 Rabbit pAb (A1162) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunohistochemistry - [KO Validated] HNRNPA2B1 Rabbit pAb (A1162)

Immunohistochemistry analysis of HNRNPA2B1 in paraffin-embedded human brain tissue using [KO Validated] HNRNPA2B1 Rabbit pAb (A1162) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - [KO Validated] HNRNPA2B1 Rabbit pAb (A1162)

Confocal immunofluorescence analysis of HeLa cells using [KO Validated] HNRNPA2B1 Rabbit pAb (A1162) at dilution of 1:400. Blue: DAPI for nuclear staining.

Review
ABclonal: review for [KO Validated] HNRNPA2B1 Rabbit pAb(A1162)

You may also interested in:

Overview

Product name [KO Validated] HNRNPA2B1 Rabbit pAb
Catalog No. A1162
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. This gene has been described to generate two alternatively spliced transcript variants which encode different isoforms.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human HNRNPA2B1 (NP_112533.1).
Sequence MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGH
Gene ID 3181
Swiss prot P22626
Synonyms RNPA2; HNRPA2; HNRPB1; SNRPB1; HNRNPA2; HNRNPB1; IBMPFD2; HNRPA2B1; B1
Calculated MW 37kDa
Observed MW 36-38kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:1000 - 1:5000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:100 - 1:500
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples A-549, HeLa, NIH/3T3, Rat spleen
Cellular location Cytoplasm, Nucleus, nucleoplasm
Customer validation

WB (293THomo sapiens, Homo sapiens, Mus musculus)

IHC (Mus musculus)

IP (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] HNRNPA2B1 Rabbit pAb images

ABclonal:Western blot - [KO Validated] HNRNPA2B1 Rabbit pAb (A1162)}

Western blot - [KO Validated] HNRNPA2B1 Rabbit pAb (A1162)

Western blot analysis of lysates from wild type (WT) and HNRNPA2B1 knockout (KO) 293T cells, using [KO Validated] HNRNPA2B1 Rabbit pAb (A1162) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - [KO Validated] HNRNPA2B1 Rabbit pAb (A1162)}

Western blot - [KO Validated] HNRNPA2B1 Rabbit pAb (A1162)

Western blot analysis of various lysates, using [KO Validated] HNRNPA2B1 Rabbit pAb (A1162) at 1:3500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - [KO Validated] HNRNPA2B1 Rabbit pAb (A1162)}

Immunohistochemistry - [KO Validated] HNRNPA2B1 Rabbit pAb (A1162)

Immunohistochemistry analysis of HNRNPA2B1 in paraffin-embedded rat lung tissue using [KO Validated] HNRNPA2B1 Rabbit pAb (A1162) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - [KO Validated] HNRNPA2B1 Rabbit pAb (A1162)}

Immunohistochemistry - [KO Validated] HNRNPA2B1 Rabbit pAb (A1162)

Immunohistochemistry analysis of HNRNPA2B1 in paraffin-embedded human cervix tissue using [KO Validated] HNRNPA2B1 Rabbit pAb (A1162) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunohistochemistry - [KO Validated] HNRNPA2B1 Rabbit pAb (A1162)}

Immunohistochemistry - [KO Validated] HNRNPA2B1 Rabbit pAb (A1162)

Immunohistochemistry analysis of HNRNPA2B1 in paraffin-embedded human brain tissue using [KO Validated] HNRNPA2B1 Rabbit pAb (A1162) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
ABclonal:Immunofluorescence - [KO Validated] HNRNPA2B1 Rabbit pAb (A1162)}

Immunofluorescence - [KO Validated] HNRNPA2B1 Rabbit pAb (A1162)

Confocal immunofluorescence analysis of HeLa cells using [KO Validated] HNRNPA2B1 Rabbit pAb (A1162) at dilution of 1:400. Blue: DAPI for nuclear staining.

Submit an review for A1162

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1162 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on HNRNPA2B1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to HNRNPA2B1. (Distance between topics and target gene indicate popularity.) HNRNPA2B1

* Data provided by citexs.com, for reference only.

Publishing research using A1162? Please let us know so that we can cite the reference in this datasheet.

ELISA Kits (1)

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order