Products > Catalog Antibodies > Monoclonal Antibodies

[KO Validated] HMGB1 Rabbit mAb (A19529)

Tested applications:WB IHC ICC IF IP ChIP ChIP-seq RIP FC ELISA MeDIP Nucleotide Array DB FACS CoIPReactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] HMGB1 Rabbit mAb (A19529)

Western blot analysis of extracts of various cell lines, using HMGB1 antibody (A19529) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

Western blot analysis of extracts from wild type (WT) and HMGB1 knockout (KO) 293T cells, using HMGB1 antibody (A19529) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.

ABclonal:Immunohistochemistry - [KO Validated] HMGB1 Rabbit mAb (A19529)

Immunohistochemistry of paraffin-embedded Rat brain using HMGB1 antibody (A19529) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry of paraffin-embedded Human esophagus using HMGB1 antibody (A19529) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry of paraffin-embedded Mouse kidney using HMGB1 antibody (A19529) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - [KO Validated] HMGB1 Rabbit mAb (A19529)

Immunofluorescence analysis of C6 cells using HMGB1 antibody (A19529) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH/3T3 cells using HMGB1 antibody (A19529) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	[KO Validated] HMGB1 Rabbit mAb
Catalog No.	A19529
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Sep 2015]

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HMGB1 (P09429).
Sequence	SAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEE
Gene ID	3146
Swiss prot	P09429
Synonyms	HMG-1; HMG1; HMG3; SBP-1; HMGB1
Calculated MW	25kDa
Observed MW	25kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC ICC IF IP ChIP ChIP-seq RIP FC ELISA MeDIP Nucleotide Array DB FACS CoIP
Recommended dilution	WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	293T, HeLa, Jurkat, Mouse liver, Mouse brain, Mouse testis, Rat liver
Cellular location	Cell membrane, Chromosome, Cytoplasm, Endoplasmic reticulum-Golgi intermediate compartment, Endosome, Extracellular side, Nucleus, Peripheral membrane protein, Secreted
Customer validation	IF(Rattus norvegicus)