Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

HER2/ErbB2 Rabbit pAb (A2071)

Publications (7) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - HER2/ErbB2 Rabbit pAb (A2071)

Western blot analysis of lysates from SK-BR-3 cells, using HER2/ErbB2 Rabbit pAb (A2071) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - HER2/ErbB2 Rabbit pAb (A2071)

Western blot analysis of lysates from Mouse lung, using HER2/ErbB2 Rabbit pAb (A2071) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - HER2/ErbB2 Rabbit pAb (A2071)

Immunohistochemistry analysis of HER2/ErbB2 in paraffin-embedded rat testis using HER2/ErbB2 Rabbit pAb (A2071) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name HER2/ErbB2 Rabbit pAb
Catalog No. A2071
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. However, it does bind tightly to other ligand-bound EGF receptor family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways, such as those involving mitogen-activated protein kinase and phosphatidylinositol-3 kinase. Allelic variations at amino acid positions 654 and 655 of isoform a (positions 624 and 625 of isoform b) have been reported, with the most common allele, Ile654/Ile655, shown here. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1156-1255 of human HER2/ErbB2 (NP_004439.2).
Sequence PTVPLPSETDGYVAPLTCSPQPEYVNQPDVRPQPPSPREGPLPAARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV
Gene ID 2064
Swiss prot P04626
Synonyms NEU; NGL; HER2; TKR1; CD340; HER-2; VSCN2; MLN 19; MLN-19; c-ERB2; c-ERB-2; HER-2/neu; p185(erbB2); HER2/ErbB2
Calculated MW 138kDa
Observed MW 185kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples SK-BR-3, Mouse lung
Cellular location Cell membrane, Cytoplasm, Nucleus, Nucleus, Single-pass type I membrane protein, perinuclear region
Customer validation

WB (Mus musculus, Homo sapiens)

IHC (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

HER2/ErbB2 Rabbit pAb images

ABclonal:Western blot - HER2/ErbB2 Rabbit pAb (A2071)}

Western blot - HER2/ErbB2 Rabbit pAb (A2071)

Western blot analysis of lysates from SK-BR-3 cells, using HER2/ErbB2 Rabbit pAb (A2071) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - HER2/ErbB2 Rabbit pAb (A2071)}

Western blot - HER2/ErbB2 Rabbit pAb (A2071)

Western blot analysis of lysates from Mouse lung, using HER2/ErbB2 Rabbit pAb (A2071) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - HER2/ErbB2 Rabbit pAb (A2071)}

Immunohistochemistry - HER2/ErbB2 Rabbit pAb (A2071)

Immunohistochemistry analysis of HER2/ErbB2 in paraffin-embedded rat testis using HER2/ErbB2 Rabbit pAb (A2071) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A2071 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ERBB2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ERBB2. (Distance between topics and target gene indicate popularity.) ERBB2

* Data provided by citexs.com, for reference only.

Publishing research using A2071? Please let us know so that we can cite the reference in this datasheet.

Antibodies (8)

ELISA Kits (1)

Proteins (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order