Product name | [KO Validated] GSS Rabbit pAb |
---|---|
Catalog No. | A14535 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 373-474 of human GSS (NP_000169.1). |
---|---|
Sequence | NLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAIEHADGGVAAGVAVLDNPYPV |
Gene ID | 2937 |
Swiss prot | P48637 |
Synonyms | GSS; GSHS; HEL-S-64p; HEL-S-88n |
Calculated MW | 40kDa/52kDa |
Observed MW | 54kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | DU145, K-562, 293T, Mouse kidney, Mouse spleen, Mouse brain, Rat kidney |
Cellular location |
Submit your question about A14535 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.