Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

[KO Validated] GARS Rabbit mAb (A0651)

KO/KDValidated

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] GARS Rabbit mAb (A0651)

Western blot analysis of Jurkat, using GARS antibody (A0651) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Western blot - [KO Validated] GARS Rabbit mAb (A0651)

Western blot analysis of various lysates, using [KO Validated] GARS Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Western blot - [KO Validated] GARS Rabbit mAb (A0651)

Western blot analysis of extracts from wild type(WT) and GARS knockout (KO) 293T cells, using GARS antibody (A0651) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

You may also interested in:

Overview

Product name [KO Validated] GARS Rabbit mAb
Catalog No. A0651
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0514

Background

This gene encodes glycyl-tRNA synthetase, one of the aminoacyl-tRNA synthetases that charge tRNAs with their cognate amino acids. The encoded enzyme is an (alpha)2 dimer which belongs to the class II family of tRNA synthetases. It has been shown to be a target of autoantibodies in the human autoimmune diseases, polymyositis or dermatomyositis. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 640-739 of human GARS (P41250).
Sequence RHGVSHKVDDSSGSIGRRYARTDEIGVAFGVTIDFDTVNKTPHTATLRDRDSMRQIRAEISELPSIVQDLANGNITWADVEARYPLFEGQETGKKETIEE
Gene ID 2617
Swiss prot P41250
Synonyms GARS; HMN5; CMT2D; DSMAV; GlyRS; HMN5A; SMAD1; SMAJI; RS
Calculated MW 83kDa
Observed MW 83kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Jurkat, 293T, Hep G2, Mouse brain, Rat brain
Cellular location Cell projection, Cytoplasm, Mitochondrion, Axon

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

[KO Validated] GARS Rabbit mAb images

ABclonal:Western blot - [KO Validated] GARS Rabbit mAb (A0651)}

Western blot - [KO Validated] GARS Rabbit mAb (A0651)

Western blot analysis of Jurkat, using GARS antibody (A0651) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Western blot - [KO Validated] GARS Rabbit mAb (A0651)}

Western blot - [KO Validated] GARS Rabbit mAb (A0651)

Western blot analysis of various lysates, using [KO Validated] GARS Rabbit mAb at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
ABclonal:Western blot - [KO Validated] GARS Rabbit mAb (A0651)}

Western blot - [KO Validated] GARS Rabbit mAb (A0651)

Western blot analysis of extracts from wild type(WT) and GARS knockout (KO) 293T cells, using GARS antibody (A0651) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Inquire About This Product

Submit your question about A0651 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GARS1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GARS1. (Distance between topics and target gene indicate popularity.) GARS1

* Data provided by citexs.com, for reference only.

Publishing research using A0651? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order