Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] FUS Rabbit pAb (A5921)

KO/KDValidated

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] FUS Rabbit pAb (A5921)

Western blot analysis of lysates from wild type (WT) and FUS knockout (KO) 293T cells, using [KO Validated] FUS Rabbit pAb (A5921) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - [KO Validated] FUS Rabbit pAb (A5921)

Immunofluorescence analysis of C6 cells using [KO Validated] FUS Rabbit pAb (A5921) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - [KO Validated] FUS Rabbit pAb (A5921)

Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] FUS Rabbit pAb (A5921) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - [KO Validated] FUS Rabbit pAb (A5921)

Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg FUS antibody (A5921). Western blot was performed from the immunoprecipitate using FUS antibody (A5921) at a dilution of 1:2000.

You may also interested in:

Overview

Product name [KO Validated] FUS Rabbit pAb
Catalog No. A5921
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a multifunctional protein component of the heterogeneous nuclear ribonucleoprotein (hnRNP) complex. The hnRNP complex is involved in pre-mRNA splicing and the export of fully processed mRNA to the cytoplasm. This protein belongs to the FET family of RNA-binding proteins which have been implicated in cellular processes that include regulation of gene expression, maintenance of genomic integrity and mRNA/microRNA processing. Alternative splicing results in multiple transcript variants. Defects in this gene result in amyotrophic lateral sclerosis type 6.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 297-526 of human FUS (NP_004951.1).
Sequence TIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY
Gene ID 2521
Swiss prot P35637
Synonyms TLS; ALS6; ETM4; FUS1; POMP75; altFUS; HNRNPP2; US
Calculated MW 53kDa
Observed MW 70kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:100
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    Immunoprecipitation    
Positive samples U-937, Jurkat
Cellular location Nucleus
Customer validation

WB (Mus musculus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] FUS Rabbit pAb images

ABclonal:Western blot - [KO Validated] FUS Rabbit pAb (A5921)}

Western blot - [KO Validated] FUS Rabbit pAb (A5921)

Western blot analysis of lysates from wild type (WT) and FUS knockout (KO) 293T cells, using [KO Validated] FUS Rabbit pAb (A5921) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunofluorescence - [KO Validated] FUS Rabbit pAb (A5921)}

Immunofluorescence - [KO Validated] FUS Rabbit pAb (A5921)

Immunofluorescence analysis of C6 cells using [KO Validated] FUS Rabbit pAb (A5921) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - [KO Validated] FUS Rabbit pAb (A5921)}

Immunofluorescence - [KO Validated] FUS Rabbit pAb (A5921)

Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] FUS Rabbit pAb (A5921) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunoprecipitation - [KO Validated] FUS Rabbit pAb (A5921)}

Immunoprecipitation - [KO Validated] FUS Rabbit pAb (A5921)

Immunoprecipitation analysis of 300 μg extracts of Jurkat cells using 3 μg FUS antibody (A5921). Western blot was performed from the immunoprecipitate using FUS antibody (A5921) at a dilution of 1:2000.

Inquire About This Product

Submit your question about A5921 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on FUS. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to FUS. (Distance between topics and target gene indicate popularity.) FUS

* Data provided by citexs.com, for reference only.

Publishing research using A5921? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order