Product name | [KO Validated] FUS Rabbit pAb |
---|---|
Catalog No. | A5921 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 297-526 of human FUS (NP_004951.1). |
---|---|
Sequence | TIESVADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFSGNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQQRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYDRGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY |
Gene ID | 2521 |
Swiss prot | P35637 |
Synonyms | FUS; ALS6; ETM4; FUS1; HNRNPP2; POMP75; TLS |
Calculated MW | 53kDa |
Observed MW | 70kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100 IP 1:50 - 1:200 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | U-937, Jurkat |
Cellular location | Nucleus |
Submit your question about A5921 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.