Product name | [KO Validated] Eif2ak2 Rabbit pAb |
---|---|
Catalog No. | A5578 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human Eif2ak2 (NP_002750.1). |
---|---|
Sequence | MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKLAVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQKEYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSGSFATTCESQSNSLVTSTLASESSSEGDFSADTSEINSNSDSLNSSSLLMNGLRNNQRKAKRSLAPRFDLPDMKETKYTVDKRFGMDFKEI |
Gene ID | 5610 |
Swiss prot | P19525 |
Synonyms | EIF2AK1; PKR; PPP1R83; PRKR; Eif2ak2; EIF2AK2 |
Calculated MW | 57kDa/62kDa |
Observed MW | 74kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:100 - 1:200 IF 1:50 - 1:200 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | HeLa, Jurkat |
Cellular location | Cytoplasm, Nucleus, perinuclear region |
Submit your question about A5578 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.