Reviews (4)Publications (18) Datasheet
Product name | [KO Validated] ERK2 Rabbit pAb |
---|---|
Catalog No. | A0229 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ERK2 (NP_620407.1). |
---|---|
Sequence | LNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK |
Gene ID | 5594 |
Swiss prot | P28482 |
Synonyms | ERK; ERK-2; ERK2; ERT1; MAPK2; P42MAPK; PRKM1; PRKM2; p38; p40; p41; p41mapk; p42-MAPK; MAPK1 |
Calculated MW | 36kDa/41kDa |
Observed MW | 42KDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | HeLa, A-549, NIH/3T3, C6, Mouse brain, Mouse thymus, Rat brain |
Cellular location | Cytoplasm, Nucleus, centrosome, cytoskeleton, microtubule organizing center, spindle |
Customer validation | (LX2, HeLa, Murine cells, Raw264.7) WB(Rattus norvegicus, Homo sapiens, Mus musculus) |
Please submit reviews to your technical sales specialist directly. Alternatively, email us at [email protected]
Submit your question about A0229 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A0229? Please let us know so that we can cite the reference in this datasheet.