Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] ERK2 Rabbit pAb (A0229)

KO/KDValidated

Reviews (4) Publications (40) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] ERK2 Rabbit pAb (A0229)

Western blot analysis of extracts of various cell lines, using ERK2 antibody (A0229) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - [KO Validated] ERK2 Rabbit pAb (A0229)

Western blot analysis of extracts from normal (control) and ERK2 knockout (KO) HeLa cells, using ERK2 antibody (A0229) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Review
ABclonal: review for [KO Validated] ERK2 Rabbit pAb(A0229)
Review
ABclonal: review for [KO Validated] ERK2 Rabbit pAb(A0229)
Review
ABclonal: review for [KO Validated] ERK2 Rabbit pAb(A0229)
Review
ABclonal: review for [KO Validated] ERK2 Rabbit pAb(A0229)

You may also interested in:

Overview

Product name [KO Validated] ERK2 Rabbit pAb
Catalog No. A0229
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the MAP kinase family. MAP kinases, also known as extracellular signal-regulated kinases (ERKs), act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. The activation of this kinase requires its phosphorylation by upstream kinases. Upon activation, this kinase translocates to the nucleus of the stimulated cells, where it phosphorylates nuclear targets. One study also suggests that this protein acts as a transcriptional repressor independent of its kinase activity. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Two alternatively spliced transcript variants encoding the same protein, but differing in the UTRs, have been reported for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 200-300 of human ERK2 (NP_002736.3).
Sequence LNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHK
Gene ID 5594
Swiss prot P28482
Synonyms ERK; p38; p40; p41; ERK2; ERT1; NS13; ERK-2; MAPK2; PRKM1; PRKM2; P42MAPK; p41mapk; p42-MAPK; K2
Calculated MW 41kDa
Observed MW 42kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples HeLa, A-549, NIH/3T3, C6, Mouse brain, Mouse thymus, Rat brain
Cellular location Cytoplasm, Nucleus, centrosome, cytoskeleton, microtubule organizing center, spindle
Customer validation

WB (Raw264.7, HeLa, LX2, Murine cellsRattus norvegicus, Homo sapiens, Mus musculus, Rattus norvegicus, Melodinus cochinchinensis, Gallus gallus)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] ERK2 Rabbit pAb images

ABclonal:Western blot - [KO Validated] ERK2 Rabbit pAb (A0229)}

Western blot - [KO Validated] ERK2 Rabbit pAb (A0229)

Western blot analysis of extracts of various cell lines, using ERK2 antibody (A0229) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - [KO Validated] ERK2 Rabbit pAb (A0229)}

Western blot - [KO Validated] ERK2 Rabbit pAb (A0229)

Western blot analysis of extracts from normal (control) and ERK2 knockout (KO) HeLa cells, using ERK2 antibody (A0229) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Submit an review for A0229

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A0229 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MAPK1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MAPK1. (Distance between topics and target gene indicate popularity.) MAPK1

* Data provided by citexs.com, for reference only.

Publishing research using A0229? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Proteins (2)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order