Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

[KO Validated] EGFR Rabbit mAb (A4929)

KO/KDValidated

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - [KO Validated] EGFR Rabbit mAb (A4929)

You may also interested in:

Overview

Product name [KO Validated] EGFR Rabbit mAb
Catalog No. A4929
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC1138

Background

The protein encoded by this gene is a transmembrane glycoprotein that is a member of the protein kinase superfamily. This protein is a receptor for members of the epidermal growth factor family. EGFR is a cell surface protein that binds to epidermal growth factor, thus inducing receptor dimerization and tyrosine autophosphorylation leading to cell proliferation. Mutations in this gene are associated with lung cancer. EGFR is a component of the cytokine storm which contributes to a severe form of Coronavirus Disease 2019 (COVID-19) resulting from infection with severe acute respiratory syndrome coronavirus-2 (SARS-CoV-2).

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 350-450 of human EGFR (NP_005219.2).
Sequence SINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGL
Gene ID 1956
Swiss prot P00533
Synonyms ERBB; ERRP; HER1; mENA; ERBB1; PIG61; NISBD2; FR
Calculated MW 134kDa
Observed MW 175kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:10000 - 1:140000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa
Cellular location Cell membrane, Endoplasmic reticulum membrane, Endosome, Endosome membrane, Golgi apparatus membrane, Nucleus membrane, Nucleus, Secreted, Single-pass type I membrane protein
Customer validation

WB (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] EGFR Rabbit mAb images

ABclonal:Western blot - [KO Validated] EGFR Rabbit mAb (A4929)}

Western blot - [KO Validated] EGFR Rabbit mAb (A4929)

Inquire About This Product

Submit your question about A4929 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on EGFR. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to EGFR. (Distance between topics and target gene indicate popularity.) EGFR

* Data provided by citexs.com, for reference only.

Publishing research using A4929? Please let us know so that we can cite the reference in this datasheet.

Antibodies (36)

ELISA Kits (1)

Proteins (5)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order