Reviews (2)Publications (4) Datasheet
Product name | [KO Validated] EGFR Rabbit pAb |
---|---|
Catalog No. | A11351 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1021-1210 of human EGFR (NP_005219.2). |
---|---|
Sequence | QGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRVAPQSSEFIGA |
Gene ID | 1956 |
Swiss prot | P00533 |
Synonyms | EGFR; ERBB; ERBB1; HER1; NISBD2; PIG61; mENA |
Calculated MW | 44kDa/69kDa/77kDa/134kDa |
Observed MW | 175kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:100 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | |
Cellular location | Cell membrane, Endoplasmic reticulum membrane, Endosome, Endosome membrane, Golgi apparatus membrane, Nucleus membrane, Nucleus, Secreted, Single-pass type I membrane protein |
Customer validation | (H1975, Human glioma) WB(Mus musculus, Zika virus, Homo sapiens) IHC(Mus musculus) |
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A11351 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A11351? Please let us know so that we can cite the reference in this datasheet.