Reviews (2) Publications (30) Datasheet COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Western blot analysis of lysates from A431 cells, using EGFR Rabbit pAb (A11351) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunohistochemistry analysis of EGFR in paraffin-embedded Rat liver using EGFR Rabbit pAb (A11351) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of EGFR in paraffin-embedded Human placenta using EGFR Rabbit pAb (A11351) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry analysis of EGFR in paraffin-embedded Mouse heart using EGFR Rabbit pAb (A11351) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunofluorescence analysis of A-431 cells using EGFR Rabbit pAb (A11351) at dilution of 1:300 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 200 μg extracts of HeLa cells using 3 μg EGFR antibody (A11351). Western blot was performed from the immunoprecipitate using EGFR antibody (A11351) at a dilution of 1:1000.
Product name | EGFR Rabbit pAb |
---|---|
Catalog No. | A11351 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1021-1210 of human EGFR (NP_005219.2). |
---|---|
Sequence | QGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRVAPQSSEFIGA |
Gene ID | 1956 |
Swiss prot | P00533 |
Synonyms | ERBB; ERRP; HER1; mENA; ERBB1; PIG61; NISBD2; EGFR |
Calculated MW | 134kDa |
Observed MW | 175kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | A431 |
Cellular location | Cell membrane, Endoplasmic reticulum membrane, Endosome, Endosome membrane, Golgi apparatus membrane, Nucleus membrane, Nucleus, Secreted, Single-pass type I membrane protein |
Customer validation | WB (H1975Mus musculus, Zika virus, Homo sapiens, Mus musculus) IHC (Human gliomaHomo sapiens, Homo sapiens, Mus musculus) IF (Homo sapiens, Mus musculus) IP (Homo sapiens) FC (Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A11351 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on EGFR. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to EGFR. (Distance between topics and target gene indicate popularity.) EGFR
* Data provided by citexs.com, for reference only.
Publishing research using A11351? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.