Product name | [KO Validated] DPYSL2 Rabbit pAb |
---|---|
Catalog No. | A14570 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human DPYSL2 (NP_001377.1). |
---|---|
Sequence | RIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAELRGVPRGLYD |
Gene ID | 1808 |
Swiss prot | Q16555 |
Synonyms | DPYSL2; CRMP-2; CRMP2; DHPRP2; DRP-2; DRP2; N2A3; ULIP-2; ULIP2 |
Calculated MW | 58kDa/62kDa |
Observed MW | 62kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry |
Positive samples | HepG2, U-251MG, 293T |
Cellular location | Cytoplasm, Membrane, cytoskeleton, cytosol |
Submit your question about A14570 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.