Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] DNAJB1 Rabbit pAb (A5504)

KO/KDValidated

Publications (5) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] DNAJB1 Rabbit pAb (A5504)

Western blot analysis of lysates from wild type (WT) and DNAJB1 knockout (KO) 293T cells, using [KO Validated] DNAJB1 Rabbit pAb (A5504) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - [KO Validated] DNAJB1 Rabbit pAb (A5504)

Western blot analysis of various lysates using [KO Validated] DNAJB1 Rabbit pAb (A5504) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 30s.

ABclonal:Western blot - [KO Validated] DNAJB1 Rabbit pAb (A5504)

Western blot analysis of lysates from 293T cells using [KO Validated] DNAJB1 Rabbit pAb(A5504) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:30s.

ABclonal:Immunofluorescence - [KO Validated] DNAJB1 Rabbit pAb (A5504)

Immunofluorescence analysis of U2OS cells using [KO Validated] DNAJB1 Rabbit pAb (A5504). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - [KO Validated] DNAJB1 Rabbit pAb (A5504)

Immunofluorescence analysis of C6 cells using [KO Validated] DNAJB1 Rabbit pAb (A5504) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - [KO Validated] DNAJB1 Rabbit pAb (A5504)

Immunofluorescence analysis of HeLa cells using [KO Validated] DNAJB1 Rabbit pAb (A5504) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name [KO Validated] DNAJB1 Rabbit pAb
Catalog No. A5504
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the DnaJ or Hsp40 (heat shock protein 40 kD) family of proteins. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. The encoded protein is a molecular chaperone that stimulates the ATPase activity of Hsp70 heat-shock proteins in order to promote protein folding and prevent misfolded protein aggregation. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-340 of human DNAJB1 (NP_006136.1).
Sequence MGKDYYQTLGLARGASDEEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGSGPSGGSGGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDPFSGFPMGMGGFTNVNFGRSRSAQEPARKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKKGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLIIEFEVIFPERIPQTSRTVLEQVLPI
Gene ID 3337
Swiss prot P25685
Synonyms Hdj1; Sis1; HSPF1; Hsp40; RSPH16B; B1
Calculated MW 38kDa
Observed MW 38kDa/38KDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples Hep G2, C2C12, Mouse testis, Rat testis, 293T
Cellular location Cytoplasm, Nucleus, nucleolus
Customer validation

WB (Mus musculus, Homo sapiens, Gallus gallus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

[KO Validated] DNAJB1 Rabbit pAb images

ABclonal:Western blot - [KO Validated] DNAJB1 Rabbit pAb (A5504)}

Western blot - [KO Validated] DNAJB1 Rabbit pAb (A5504)

Western blot analysis of lysates from wild type (WT) and DNAJB1 knockout (KO) 293T cells, using [KO Validated] DNAJB1 Rabbit pAb (A5504) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - [KO Validated] DNAJB1 Rabbit pAb (A5504)}

Western blot - [KO Validated] DNAJB1 Rabbit pAb (A5504)

Western blot analysis of various lysates using [KO Validated] DNAJB1 Rabbit pAb (A5504) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime: 30s.
ABclonal:Western blot - [KO Validated] DNAJB1 Rabbit pAb (A5504)}

Western blot - [KO Validated] DNAJB1 Rabbit pAb (A5504)

Western blot analysis of lysates from 293T cells using [KO Validated] DNAJB1 Rabbit pAb(A5504) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection:ECL Basic Kit (RM00020).
Exposuretime:30s.
ABclonal:Immunofluorescence - [KO Validated] DNAJB1 Rabbit pAb (A5504)}

Immunofluorescence - [KO Validated] DNAJB1 Rabbit pAb (A5504)

Immunofluorescence analysis of U2OS cells using [KO Validated] DNAJB1 Rabbit pAb (A5504). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - [KO Validated] DNAJB1 Rabbit pAb (A5504)}

Immunofluorescence - [KO Validated] DNAJB1 Rabbit pAb (A5504)

Immunofluorescence analysis of C6 cells using [KO Validated] DNAJB1 Rabbit pAb (A5504) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - [KO Validated] DNAJB1 Rabbit pAb (A5504)}

Immunofluorescence - [KO Validated] DNAJB1 Rabbit pAb (A5504)

Immunofluorescence analysis of HeLa cells using [KO Validated] DNAJB1 Rabbit pAb (A5504) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A5504 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on DNAJB1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to DNAJB1. (Distance between topics and target gene indicate popularity.) DNAJB1

* Data provided by citexs.com, for reference only.

Publishing research using A5504? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order