Tested applications:WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Human
Product name | [KO Validated] Caspase-8 Rabbit mAb |
---|---|
Catalog No. | A19549 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 200-300 of human Caspase-8 (Q14790). |
---|---|
Sequence | EELCGVMTISDSPREQDSESQTLDKVYQMKSKPRGYCLIINNHNFAKAREKVPKLHSIRDRNGTHLDAGALTTTFEELHFEIKPHDDCTVEQIYEILKIYQ |
Gene ID | 841 |
Swiss prot | Q14790 |
Synonyms | ALPS2B; CAP4; Casp-8; FLICE; MACH; MCH5; Caspase 8; CASP8; Caspase-8; caspase-8 |
Calculated MW | 55kDa |
Observed MW | 55KDa |
Reactivity | Human |
---|---|
Tested applications | WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting |
Positive samples | Jurkat, HepG2, HeLa |
Cellular location | Cytoplasm |
Customer validation | WB(Homo sapiens,Mus musculus) |
Submit your question about A19549 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A19549? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.