Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] NG2/CSPG4 Rabbit pAb (A3592)

KO/KDValidated

Publications (4) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] NG2/CSPG4 Rabbit pAb (A3592)

Western blot analysis of lysates from A375 cells, using [KO Validated] NG2/CSPG4 Rabbit pAb (A3592) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - [KO Validated] NG2/CSPG4 Rabbit pAb (A3592)

Western blot analysis of various lysates using [KO Validated] NG2/CSPG4 Rabbit pAb (A3592) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Western blot - [KO Validated] NG2/CSPG4 Rabbit pAb (A3592)

Western blot analysis of lysates from wild type (WT) and NG2/CSPG4 knockout (KO) HeLa cells, using [KO Validated] NG2/CSPG4 Rabbit pAb (A3592) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

You may also interested in:

Overview

Product name [KO Validated] NG2/CSPG4 Rabbit pAb
Catalog No. A3592
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

A human melanoma-associated chondroitin sulfate proteoglycan plays a role in stabilizing cell-substratum interactions during early events of melanoma cell spreading on endothelial basement membranes. CSPG4 represents an integral membrane chondroitin sulfate proteoglycan expressed by human malignant melanoma cells.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1340-1563 of human NG2/CSPG4 (NP_001888.2).
Sequence LGAPLEGVLVELEVLPAAIPLEAQNFSVPEGGSLTLAPPLLRVSGPYFPTLLGLSLQVLEPPQHGALQKEDGPQARTLSAFSWRMVEEQLIRYVHDGSETLTDSFVLMANASEMDRQSHPVAFTVTVLPVNDQPPILTTNTGLQMWEGATAPIPAEALRSTDGDSGSEDLVYTIEQPSNGRVVLRGAPGTEVRSFTQAQLDGGLVLFSHRGTLDGGFRFRLSDG
Gene ID 1464
Swiss prot Q6UVK1
Synonyms NG2; MCSP; MCSPG; MSK16; CSPG4A; HMW-MAA; MEL-CSPG; G4
Calculated MW 251kDa
Observed MW 250kDa-450kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples HeLa, A375, Mouse heart, Rat brain, Rat heart
Cellular location Apical cell membrane, Cell projection, Extracellular side, Single-pass type I membrane protein, lamellipodium membrane
Customer validation

IF (Mus musculus)

WB (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] NG2/CSPG4 Rabbit pAb images

ABclonal:Western blot - [KO Validated] NG2/CSPG4 Rabbit pAb (A3592)}

Western blot - [KO Validated] NG2/CSPG4 Rabbit pAb (A3592)

Western blot analysis of lysates from A375 cells, using [KO Validated] NG2/CSPG4 Rabbit pAb (A3592) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - [KO Validated] NG2/CSPG4 Rabbit pAb (A3592)}

Western blot - [KO Validated] NG2/CSPG4 Rabbit pAb (A3592)

Western blot analysis of various lysates using [KO Validated] NG2/CSPG4 Rabbit pAb (A3592) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Western blot - [KO Validated] NG2/CSPG4 Rabbit pAb (A3592)}

Western blot - [KO Validated] NG2/CSPG4 Rabbit pAb (A3592)

Western blot analysis of lysates from wild type (WT) and NG2/CSPG4 knockout (KO) HeLa cells, using [KO Validated] NG2/CSPG4 Rabbit pAb (A3592) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Inquire About This Product

Submit your question about A3592 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CSPG4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CSPG4. (Distance between topics and target gene indicate popularity.) CSPG4

* Data provided by citexs.com, for reference only.

Publishing research using A3592? Please let us know so that we can cite the reference in this datasheet.

Antibodies (7)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order