Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] CDKN2A/p16INK4a Rabbit pAb (A0262)

KO/KDValidated

Publications (61) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - [KO Validated] CDKN2A/p16INK4a Rabbit pAb (A0262)

Western blot analysis of lysates from HeLa cells, using [KO Validated] CDKN2A/p16INK4a Rabbit pAb (A0262) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Western blot - [KO Validated] CDKN2A/p16INK4a Rabbit pAb (A0262)

Western blot analysis of lysates from wild type(WT) and CDKN2A/p16INK4a knockout (KO) 293T(KO) cells, using [KO Validated] CDKN2A/p16INK4a Rabbit pAb (A0262) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - [KO Validated] CDKN2A/p16INK4a Rabbit pAb (A0262)

Immunofluorescence analysis of HeLa cells using [KO Validated] CDKN2A/p16INK4a Rabbit pAb (A0262) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name [KO Validated] CDKN2A/p16INK4a Rabbit pAb
Catalog No. A0262
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene generates several transcript variants which differ in their first exons. At least three alternatively spliced variants encoding distinct proteins have been reported, two of which encode structurally related isoforms known to function as inhibitors of CDK4 kinase. The remaining transcript includes an alternate first exon located 20 Kb upstream of the remainder of the gene; this transcript contains an alternate open reading frame (ARF) that specifies a protein which is structurally unrelated to the products of the other variants. This ARF product functions as a stabilizer of the tumor suppressor protein p53 as it can interact with, and sequester, the E3 ubiquitin-protein ligase MDM2, a protein responsible for the degradation of p53. In spite of the structural and functional differences, the CDK inhibitor isoforms and the ARF product encoded by this gene, through the regulatory roles of CDK4 and p53 in cell cycle G1 progression, share a common functionality in cell cycle G1 control. This gene is frequently mutated or deleted in a wide variety of tumors, and is known to be an important tumor suppressor gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-156 of human CDKN2A/p16INK4a (NP_000068.1).
Sequence MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD
Gene ID 1029
Swiss prot P42771Q8N726
Synonyms ARF; MLM; P14; P16; P19; CMM2; INK4; MTS1; TP16; CDK4I; CDKN2; INK4A; MTS-1; P14ARF; P19ARF; P16INK4; P16INK4A; P16-INK4A; 4a
Calculated MW 8kDa/11kDa/12kDa/13kDa/16kDa/17kDa
Observed MW 16kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    
Positive samples 293T, HeLa
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Homo sapiens, Rattus norvegicus, Mus musculus)

IF (Mus musculus, Rattus norvegicus, Homo sapiens)

IHC (Mus musculus, Homo sapiens, Rattus norvegicus)

ICC (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] CDKN2A/p16INK4a Rabbit pAb images

ABclonal:Western blot - [KO Validated] CDKN2A/p16INK4a Rabbit pAb (A0262)}

Western blot - [KO Validated] CDKN2A/p16INK4a Rabbit pAb (A0262)

Western blot analysis of lysates from HeLa cells, using [KO Validated] CDKN2A/p16INK4a Rabbit pAb (A0262) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Western blot - [KO Validated] CDKN2A/p16INK4a Rabbit pAb (A0262)}

Western blot - [KO Validated] CDKN2A/p16INK4a Rabbit pAb (A0262)

Western blot analysis of lysates from wild type(WT) and CDKN2A/p16INK4a knockout (KO) 293T(KO) cells, using [KO Validated] CDKN2A/p16INK4a Rabbit pAb (A0262) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunofluorescence - [KO Validated] CDKN2A/p16INK4a Rabbit pAb (A0262)}

Immunofluorescence - [KO Validated] CDKN2A/p16INK4a Rabbit pAb (A0262)

Immunofluorescence analysis of HeLa cells using [KO Validated] CDKN2A/p16INK4a Rabbit pAb (A0262) at dilution of 1:200 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A0262 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CDKN2A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CDKN2A. (Distance between topics and target gene indicate popularity.) CDKN2A

* Data provided by citexs.com, for reference only.

Publishing research using A0262? Please let us know so that we can cite the reference in this datasheet.

Antibodies (7)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order