Product name | [KO Validated] CDK8 Rabbit pAb |
---|---|
Catalog No. | A5548 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 365-464 of human CDK8 (NP_001251.1). |
---|---|
Sequence | DDKGDKKNQQQQQGNNHTNGTGHPGNQDSSHTQGPPLKKVRVVPPTTTSGGLIMTSDYQRSNPHAAYPNPGPSTSQPQSSMGYSATSQQPPQYSHQTHRY |
Gene ID | 1024 |
Swiss prot | P49336 |
Synonyms | CDK8; K35 |
Calculated MW | 53kDa |
Observed MW | 56kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IP 1:50 - 1:100 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunoprecipitation |
Positive samples | Jurkat |
Cellular location | Nucleus |
Submit your question about A5548 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.