Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

CDK6 Rabbit pAb (A1545)

Review (1) Publications (11) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse

ABclonal:Western blot - CDK6 Rabbit pAb (A1545)

Western blot analysis of lysates from HeLa cells, using CDK6 Rabbit pAb (A1545) at 1:900 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.

ABclonal:Immunohistochemistry - CDK6 Rabbit pAb (A1545)

Immunohistochemistry analysis of CDK6 in paraffin-embedded human colon carcinoma using CDK6 Rabbit pAb (A1545) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunoprecipitation - CDK6 Rabbit pAb (A1545)

Immunoprecipitation analysis of 200 μg extracts of Jurkat cells, using 3 μg CDK6 antibody (A1545). Western blot was performed from the immunoprecipitate using CDK6 antibody (A1545) at a dilution of 1:1000.

Review
ABclonal: review for CDK6 Rabbit pAb(A1545)

You may also interested in:

Overview

Product name CDK6 Rabbit pAb
Catalog No. A1545
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the CMGC family of serine/threonine protein kinases. This kinase is a catalytic subunit of the protein kinase complex that is important for cell cycle G1 phase progression and G1/S transition. The activity of this kinase first appears in mid-G1 phase, which is controlled by the regulatory subunits including D-type cyclins and members of INK4 family of CDK inhibitors. This kinase, as well as CDK4, has been shown to phosphorylate, and thus regulate the activity of, tumor suppressor protein Rb. Altered expression of this gene has been observed in multiple human cancers. A mutation in this gene resulting in reduced cell proliferation, and impaired cell motility and polarity, and has been identified in patients with primary microcephaly.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 226-326 of human CDK6 (NP_001250.1).
Sequence DQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA
Gene ID 1021
Swiss prot Q00534
Synonyms MCPH12; PLSTIRE; CDK6
Calculated MW 37kDa
Observed MW 40kDa

Applications

Reactivity Human, Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples HeLa
Cellular location Cell projection, Cytoplasm, Nucleus, centrosome, cytoskeleton, microtubule organizing center, ruffle
Customer validation

WB (HepG2Mus musculus, Homo sapiens)

IHC (Homo sapiens)

IF (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

CDK6 Rabbit pAb images

ABclonal:Western blot - CDK6 Rabbit pAb (A1545)}

Western blot - CDK6 Rabbit pAb (A1545)

Western blot analysis of lysates from HeLa cells, using CDK6 Rabbit pAb (A1545) at 1:900 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.
ABclonal:Immunohistochemistry - CDK6 Rabbit pAb (A1545)}

Immunohistochemistry - CDK6 Rabbit pAb (A1545)

Immunohistochemistry analysis of CDK6 in paraffin-embedded human colon carcinoma using CDK6 Rabbit pAb (A1545) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunoprecipitation - CDK6 Rabbit pAb (A1545)}

Immunoprecipitation - CDK6 Rabbit pAb (A1545)

Immunoprecipitation analysis of 200 μg extracts of Jurkat cells, using 3 μg CDK6 antibody (A1545). Western blot was performed from the immunoprecipitate using CDK6 antibody (A1545) at a dilution of 1:1000.

Submit an review for A1545

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A1545 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on CDK6. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to CDK6. (Distance between topics and target gene indicate popularity.) CDK6

* Data provided by citexs.com, for reference only.

Publishing research using A1545? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order