Western blot analysis of extracts of various cell lines, using CD44 antibody (A12410) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Western blot analysis of extracts of HeLa cells, using CD44 antibody (A12410) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
Immunohistochemistry of paraffin-embedded human esophageal cancer using [KO Validated] CD44 Rabbit pAb (A12410) at dilution of 1:250 (40x lens).
Immunohistochemistry of paraffin-embedded human lung cancer using [KO Validated] CD44 Rabbit pAb (A12410) at dilution of 1:250 (40x lens).
Immunofluorescence analysis of HeLa cells using CD44 antibody (A12410) at dilution of 1:100. Blue: DAPI for nuclear staining.
Confocal immunofluorescence analysis of A431 cells using CD44 antibody (A12410) at dilution of 1:200. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of RAW264.7 cells using CD44 antibody (A12410) at dilution of 1:100. Blue: DAPI for nuclear staining.
| Product name | [KO Validated] CD44 Rabbit pAb |
|---|---|
| Catalog No. | A12410 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 148-247 of human CD44 (NP_001189486.1). |
|---|---|
| Sequence | VNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHPIPDEDSPWITDSTDRIPATRDQDTFHPSGGSHTTHGSESDGHSH |
| Gene ID | 960 |
| Swiss prot | P16070 |
| Synonyms | CDW44; CSPG8; ECMR-III; HCELL; HUTCH-I; IN; LHR; MC56; MDU2; MDU3; MIC4; Pgp1; CD44; CD44 |
| Calculated MW | 3kDa/15kDa/32-53kDa/73-81kDa |
| Observed MW | 80KDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP |
| Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 |
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Application key | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | HeLa, HUVEC, Mouse spleen |
| Cellular location | Cell membrane, Single-pass type I membrane protein |
| Customer validation | FC(Homo sapiens) IF(Mus musculus) WB(Homo sapiens) |
* For research use only. Not for therapeutic or diagnostic purposes.
Submit your question about A12410 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A12410? Please let us know so that we can cite the reference in this datasheet.
![ABclonal:Western blot - [KO Validated] CD44 Rabbit pAb (A12410)](/Uploads/Catalog/A12410/A12410_1.jpg?t=1623053564 "ABclonal:Western blot - [KO Validated] CD44 Rabbit pAb (A12410)")
![ABclonal:Western blot - [KO Validated] CD44 Rabbit pAb (A12410)](/Uploads/Catalog/A12410/A12410_2.jpg?t=1623053570 "ABclonal:Western blot - [KO Validated] CD44 Rabbit pAb (A12410)")
![ABclonal:Immunohistochemistry - [KO Validated] CD44 Rabbit pAb (A12410)](/Uploads/Catalog/A12410/A12410_3.jpg?t=1623053588 "ABclonal:Immunohistochemistry - [KO Validated] CD44 Rabbit pAb (A12410)")
![ABclonal:Immunohistochemistry - [KO Validated] CD44 Rabbit pAb (A12410)](/Uploads/Catalog/A12410/A12410_4.jpg?t=1623053604 "ABclonal:Immunohistochemistry - [KO Validated] CD44 Rabbit pAb (A12410)")
![ABclonal:Immunofluorescence - [KO Validated] CD44 Rabbit pAb (A12410)](/Uploads/Catalog/A12410/A12410_5.jpg?t=1623053610 "ABclonal:Immunofluorescence - [KO Validated] CD44 Rabbit pAb (A12410)")
![ABclonal:Immunofluorescence - [KO Validated] CD44 Rabbit pAb (A12410)](/Uploads/Catalog/A12410/A12410_6.jpg?t=1623053620 "ABclonal:Immunofluorescence - [KO Validated] CD44 Rabbit pAb (A12410)")
![ABclonal:Immunofluorescence - [KO Validated] CD44 Rabbit pAb (A12410)](/Uploads/Catalog/A12410/A12410_7.jpg?t=1623053629 "ABclonal:Immunofluorescence - [KO Validated] CD44 Rabbit pAb (A12410)")
![ABclonal:Immunofluorescence - [KO Validated] CD44 Rabbit pAb (A12410)](/Uploads/Catalog/A12410/A12410_8.jpg?t=1623053639 "ABclonal:Immunofluorescence - [KO Validated] CD44 Rabbit pAb (A12410)")
