Tested applications:WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Human, Mouse, Rat
Product name | [KO Validated] CD44 Rabbit pAb |
---|---|
Catalog No. | A12410 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-178 of human CD44 (NP_000601.3). |
---|---|
Sequence | AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV |
Gene ID | 960 |
Swiss prot | P16070 |
Synonyms | CDW44; CSPG8; ECMR-III; HCELL; HUTCH-I; IN; LHR; MC56; MDU2; MDU3; MIC4; Pgp1; CD44; CD44 |
Calculated MW | 3kDa/15kDa/32-53kDa/73-81kDa |
Observed MW | 80KDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | HeLa, HUVEC, Mouse spleen |
Cellular location | Cell membrane, Single-pass type I membrane protein |
Customer validation | FC(Homo sapiens) IF(Mus musculus) WB(Homo sapiens) |
Submit your question about A12410 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A12410? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.