Products > Catalog Antibodies > Polyclonal Antibodies

[KO Validated] CD44 Rabbit pAb (A12410)

Tested applications:WB IHC ICC IF IP ChIP ChIP-seq RIP FC ELISA MeDIP Nucleotide Array DB FACS CoIPReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using CD44 antibody (A12410) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Western blot analysis of extracts of HeLa cells, using CD44 antibody (A12410) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunohistochemistry - [KO Validated] CD44 Rabbit pAb (A12410)

Immunohistochemistry of paraffin-embedded human esophageal cancer using [KO Validated] CD44 Rabbit pAb (A12410) at dilution of 1:250 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry of paraffin-embedded human lung cancer using [KO Validated] CD44 Rabbit pAb (A12410) at dilution of 1:250 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - [KO Validated] CD44 Rabbit pAb (A12410)

Immunofluorescence analysis of HeLa cells using CD44 antibody (A12410) at dilution of 1:100. Blue: DAPI for nuclear staining.

Confocal immunofluorescence analysis of A431 cells using CD44 antibody (A12410) at dilution of 1:200. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of RAW264.7 cells using CD44 antibody (A12410) at dilution of 1:100. Blue: DAPI for nuclear staining.

Confocal immunofluorescence analysis of HeLa cells using [KO Validated] CD44 Polyclonal Antibody (A12410) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	[KO Validated] CD44 Rabbit pAb
Catalog No.	A12410
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a cell-surface glycoprotein involved in cell-cell interactions, cell adhesion and migration. It is a receptor for hyaluronic acid (HA) and can also interact with other ligands, such as osteopontin, collagens, and matrix metalloproteinases (MMPs). This protein participates in a wide variety of cellular functions including lymphocyte activation, recirculation and homing, hematopoiesis, and tumor metastasis. Transcripts for this gene undergo complex alternative splicing that results in many functionally distinct isoforms, however, the full length nature of some of these variants has not been determined. Alternative splicing is the basis for the structural and functional diversity of this protein, and may be related to tumor metastasis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 20-178 of human CD44 (NP_000601.3).
Sequence	AQIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGFIEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGPITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDV
Gene ID	960
Swiss prot	P16070
Synonyms	CDW44; CSPG8; ECMR-III; HCELL; HUTCH-I; IN; LHR; MC56; MDU2; MDU3; MIC4; Pgp1; CD44; CD44
Calculated MW	3kDa/15kDa/32-53kDa/73-81kDa
Observed MW	80KDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC ICC IF IP ChIP ChIP-seq RIP FC ELISA MeDIP Nucleotide Array DB FACS CoIP
Recommended dilution	WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HeLa, HUVEC, Mouse spleen
Cellular location	Cell membrane, Single-pass type I membrane protein
Customer validation	FC(Homo sapiens) IF(Mus musculus) WB(Homo sapiens)

Research Area

[KO Validated] CD44 Rabbit pAb images

Western blot - [KO Validated] CD44 Rabbit pAb (A12410)

Immunohistochemistry - [KO Validated] CD44 Rabbit pAb (A12410)

Immunofluorescence - [KO Validated] CD44 Rabbit pAb (A12410)

Immunofluorescence analysis of HeLa cells using CD44 antibody (A12410) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence - [KO Validated] CD44 Rabbit pAb (A12410)

Confocal immunofluorescence analysis of A431 cells using CD44 antibody (A12410) at dilution of 1:200. Blue: DAPI for nuclear staining.

Immunofluorescence - [KO Validated] CD44 Rabbit pAb (A12410)

Immunofluorescence analysis of RAW264.7 cells using CD44 antibody (A12410) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence - [KO Validated] CD44 Rabbit pAb (A12410)

Confocal immunofluorescence analysis of HeLa cells using [KO Validated] CD44 Polyclonal Antibody (A12410) at dilution of 1:100. Blue: DAPI for nuclear staining.