Product name | [KO Validated] CBX3 Rabbit pAb |
---|---|
Catalog No. | A2248 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-183 of human CBX3 (NP_009207.2). |
---|---|
Sequence | MASNKTTLQKMGKKQNGKSKKVEEAEPEEFVVEKVLDRRVVNGKVEYFLKWKGFTDADNTWEPEENLDCPELIEAFLNSQKAGKEKDGTKRKSLSDSESDDSKSKKKRDAADKPRGFARGLDPERIIGATDSSGELMFLMKWKDSDEADLVLAKEANMKCPQIVIAFYEERLTWHSCPEDEAQ |
Gene ID | 11335 |
Swiss prot | Q13185 |
Synonyms | CBX3; HECH; HP1-GAMMA; HP1Hs-gamma |
Calculated MW | 20kDa |
Observed MW | 23kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | HeLa, MCF-7, 293T, A-549, NCI-H460, Mouse brain, Mouse lung, Mouse spleen |
Cellular location | Nucleus |
Customer validation | WB(Mus musculus) IHC(Mus musculus) |
Submit your question about A2248 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A2248? Please let us know so that we can cite the reference in this datasheet.