Reviews (6)Publications (27) Datasheet
Western blot analysis of extracts of various cell lines, using Beclin 1 antibody (A7353) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Western blot analysis of extracts from normal (control) and Beclin 1 knockout (KO) 293T cells, using Beclin 1 antibody (A7353) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
Immunohistochemistry of paraffin-embedded human stomach using Beclin 1 antibody (A7353) at dilution of 1:100 (40x lens).
Immunohistochemistry of paraffin-embedded mouse kidney using Beclin 1 antibody (A7353) at dilution of 1:100 (40x lens).
Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] Beclin 1 Rabbit pAb (A7353) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using [KO Validated] Beclin 1 Rabbit pAb (A7353) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.
Immunoprecipitation analysis of 200ug extracts of HeLa cells using 3ug Beclin 1 antibody (A7353). Western blot was performed from the immunoprecipitate using Beclin 1 antibody (A7353) at a dilition of 1:1000.
| Product name | [KO Validated] Beclin 1 Rabbit pAb |
|---|---|
| Catalog No. | A7353 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Beclin 1 (NP_003757.1). |
|---|---|
| Sequence | MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSG |
| Gene ID | 8678 |
| Swiss prot | Q14457 |
| Synonyms | ATG6; VPS30; beclin1; Beclin 1; BECN1; beclin-1 |
| Calculated MW | 51kDa |
| Observed MW | 60kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP |
| Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:100 |
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Application key | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
| Positive samples | 293T, U-87MG, HeLa, MCF7, Mouse spleen, Rat ovary, Rat lung |
| Cellular location | Cytoplasm, Cytoplasmic vesicle, Endoplasmic reticulum membrane, Endosome, Endosome membrane, Golgi apparatus, Mitochondrion, Mitochondrion membrane, Nucleus, Peripheral membrane protein, autophagosome, trans-Golgi network membrane |
| Customer validation | (C2C12, A549,Mouse kidney, U2OS,Saos-2, Human Isikawa , NPCs) WB(Homo sapiens, Gallus gallus, Mus musculus, Spodoptera frugiperda, Sus scrofa, Rattus norvegicus) IF(Sus scrofa) IHC(Mus musculus) IHC(Mus musculus) WB(Mus musculus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A7353 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A7353? Please let us know so that we can cite the reference in this datasheet.
![ABclonal:[KO Validated] Beclin 1 Rabbit pAb](/Public/Images/Antibody_thumb.jpg "ABclonal:{title}")
![ABclonal:Western blot - [KO Validated] Beclin 1 Rabbit pAb (A7353)](/Uploads/Catalog/A7353/A7353_1.jpg?t=1624583747 "ABclonal:Western blot - [KO Validated] Beclin 1 Rabbit pAb (A7353)")
![ABclonal:Western blot - [KO Validated] Beclin 1 Rabbit pAb (A7353)](/Uploads/Catalog/A7353/A7353_2.jpg?t=1624583751 "ABclonal:Western blot - [KO Validated] Beclin 1 Rabbit pAb (A7353)")
![ABclonal:Immunohistochemistry - [KO Validated] Beclin 1 Rabbit pAb (A7353)](/Uploads/Catalog/A7353/A7353_3.jpg?t=1624583763 "ABclonal:Immunohistochemistry - [KO Validated] Beclin 1 Rabbit pAb (A7353)")
![ABclonal:Immunohistochemistry - [KO Validated] Beclin 1 Rabbit pAb (A7353)](/Uploads/Catalog/A7353/A7353_4.jpg?t=1624583772 "ABclonal:Immunohistochemistry - [KO Validated] Beclin 1 Rabbit pAb (A7353)")
![ABclonal:Immunofluorescence - [KO Validated] Beclin 1 Rabbit pAb (A7353)](/Uploads/Catalog/A7353/A7353_5.jpg?t=1624583780 "ABclonal:Immunofluorescence - [KO Validated] Beclin 1 Rabbit pAb (A7353)")
![ABclonal:Immunofluorescence - [KO Validated] Beclin 1 Rabbit pAb (A7353)](/Uploads/Catalog/A7353/A7353_6.jpg?t=1624583785 "ABclonal:Immunofluorescence - [KO Validated] Beclin 1 Rabbit pAb (A7353)")
![ABclonal:Immunoprecipitation - [KO Validated] Beclin 1 Rabbit pAb (A7353)](/Uploads/Catalog/A7353/A7353_7.jpg?t=1624583787 "ABclonal:Immunoprecipitation - [KO Validated] Beclin 1 Rabbit pAb (A7353)")
![ABclonal: review for [KO Validated] Beclin 1 Rabbit pAb(A7353)](/Uploads/ReviewImages/A7353_20200106172139_FB0000535.jpg "ABclonal: review for [KO Validated] Beclin 1 Rabbit pAb(A7353)")
![ABclonal: review for [KO Validated] Beclin 1 Rabbit pAb(A7353)](/Uploads/ReviewImages/A7353_20200106172047_FB0000606.jpg "ABclonal: review for [KO Validated] Beclin 1 Rabbit pAb(A7353)")
![ABclonal: review for [KO Validated] Beclin 1 Rabbit pAb(A7353)](/Uploads/ReviewImages/A7353_20200106172027_FB0000607.jpg "ABclonal: review for [KO Validated] Beclin 1 Rabbit pAb(A7353)")
![ABclonal: review for [KO Validated] Beclin 1 Rabbit pAb(A7353)](/Uploads/ReviewImages/A7353_20200106172042_FB0000688.jpg "ABclonal: review for [KO Validated] Beclin 1 Rabbit pAb(A7353)")
![ABclonal: review for [KO Validated] Beclin 1 Rabbit pAb(A7353)](/Uploads/ReviewImages/A7353_20200106171957_FB0000798.jpg "ABclonal: review for [KO Validated] Beclin 1 Rabbit pAb(A7353)")
![ABclonal: review for [KO Validated] Beclin 1 Rabbit pAb(A7353)](/Uploads/ReviewImages/A7353_20200106171958_FB0000799.jpg "ABclonal: review for [KO Validated] Beclin 1 Rabbit pAb(A7353)")
