Reviews (6)Publications (26) Datasheet
Product name | [KO Validated] Beclin 1 Rabbit pAb |
---|---|
Catalog No. | A7353 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human Beclin 1 (NP_003757.1). |
---|---|
Sequence | MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSG |
Gene ID | 8678 |
Swiss prot | Q14457 |
Synonyms | ATG6; VPS30; beclin1; Beclin 1; BECN1; beclin-1 |
Calculated MW | 51kDa |
Observed MW | 60kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:100 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
Positive samples | 293T, U-87MG, HeLa, MCF7, Mouse spleen, Rat ovary, Rat lung |
Cellular location | Cytoplasm, Cytoplasmic vesicle, Endoplasmic reticulum membrane, Endosome, Endosome membrane, Golgi apparatus, Mitochondrion, Mitochondrion membrane, Nucleus, Peripheral membrane protein, autophagosome, trans-Golgi network membrane |
Customer validation | (C2C12, A549,Mouse kidney, U2OS,Saos-2, Human Isikawa , NPCs) WB(Mus musculus, Sus scrofa, Rattus norvegicus, Homo sapiens, Gallus gallus) IHC(Mus musculus) IHC(Mus musculus) WB(Mus musculus) IF(Sus scrofa) |
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A7353 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A7353? Please let us know so that we can cite the reference in this datasheet.