Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

Bax Rabbit mAb (A19684)

Publications (91) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - Bax Rabbit mAb (A19684)

Western blot analysis of various lysates using Bax Rabbit mAb (A19684) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Western blot - Bax Rabbit mAb (A19684)

Western blot analysis of various lysates using Bax Rabbit mAb (A19684) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Western blot - Bax Rabbit mAb (A19684)

Western blot analysis of lysates from wild type (WT) and Bax knockout (KO) 293T cells using Bax Rabbit mAb (A19684) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunohistochemistry - Bax Rabbit mAb (A19684)

Immunohistochemistry analysis of Bax in paraffin-embedded rat spleen using Bax Rabbit mAb (A19684) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - Bax Rabbit mAb (A19684)

Immunohistochemistry analysis of Bax in paraffin-embedded human colon carcinoma using Bax Rabbit mAb (A19684) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Bax Rabbit mAb (A19684)

Immunofluorescence analysis of L929 cells using Bax Rabbit mAb (A19684). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name Bax Rabbit mAb
Catalog No. A19684
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0164

Background

The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. The association and the ratio of BAX to BCL2 also determines survival or death of a cell following an apoptotic stimulus. This protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Bax (Q07812).
Sequence MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
Gene ID 581
Swiss prot Q07812
Synonyms BCL2L4; Bax
Calculated MW 21kDa
Observed MW 21kDa/

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IHC-P HumanRat
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples 293T, Raji, HeLa, Mouse lung, RAW 264.7, Rat testis, Rat lung, Raji, RAW 264.7, 293T
Cellular location Cytoplasm, Cytoplasm, Mitochondrion membrane, Single-pass membrane protein
Customer validation

WB (Mus musculus, Sanghuangporus vaninii, Rattus norvegicus, Homo sapiens, Sus scrofa, Fathead minnow, Dianella ensifolia, Homo sapiensMus musculus)

IHC (Rattus norvegicus)

IB (Homo sapiens, Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Bax Rabbit mAb images

ABclonal:Western blot - Bax Rabbit mAb (A19684)}

Western blot - Bax Rabbit mAb (A19684)

Western blot analysis of various lysates using Bax Rabbit mAb (A19684) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Western blot - Bax Rabbit mAb (A19684)}

Western blot - Bax Rabbit mAb (A19684)

Western blot analysis of various lysates using Bax Rabbit mAb (A19684) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates / proteins: 25 μg per lane.
Blocking buffer: 3 % nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Western blot - Bax Rabbit mAb (A19684)}

Western blot - Bax Rabbit mAb (A19684)

Western blot analysis of lysates from wild type (WT) and Bax knockout (KO) 293T cells using Bax Rabbit mAb (A19684) at 1:1000 dilution.
Secondary antibody:HRP Goat Anti-Rabbit IgG (H+L)(AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Immunohistochemistry - Bax Rabbit mAb (A19684)}

Immunohistochemistry - Bax Rabbit mAb (A19684)

Immunohistochemistry analysis of Bax in paraffin-embedded rat spleen using Bax Rabbit mAb (A19684) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - Bax Rabbit mAb (A19684)}

Immunohistochemistry - Bax Rabbit mAb (A19684)

Immunohistochemistry analysis of Bax in paraffin-embedded human colon carcinoma using Bax Rabbit mAb (A19684) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - Bax Rabbit mAb (A19684)}

Immunofluorescence - Bax Rabbit mAb (A19684)

Immunofluorescence analysis of L929 cells using Bax Rabbit mAb (A19684). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A19684 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on BAX. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to BAX. (Distance between topics and target gene indicate popularity.) BAX

* Data provided by citexs.com, for reference only.

Publishing research using A19684? Please let us know so that we can cite the reference in this datasheet.

Antibodies (10)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order