Publications (8) Datasheet SDS COA
Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Reactivity:Human, Mouse, Rat
Product name | [KO Validated] APP Rabbit mAb |
---|---|
Catalog No. | A17911 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC0465 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 671-770 of human APP (P05067). |
---|---|
Sequence | MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN |
Gene ID | 351 |
Swiss prot | P05067 |
Synonyms | AAA; AD1; PN2; ABPP; APPI; CVAP; ABETA; PN-II; preA4; CTFgamma; alpha-sAPP; PP |
Calculated MW | 87kDa |
Observed MW | 100-140kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | Testing results |
IF/ICC | |
WB | |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Application key | Western blotting Immunofluorescence Immunoprecipitation |
Positive samples | 293T, HeLa, U-87 MG, Mouse brain, Rat brain |
Cellular location | Membrane, Single-pass type I membrane protein, clathrin-coated pit |
Customer validation | IF (Rattus norvegicus, Mus musculus) WB (Homo sapiens, Rattus norvegicus, Mus musculus) IHC (Rattus norvegicus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A17911 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on APP. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to APP. (Distance between topics and target gene indicate popularity.) APP
* Data provided by citexs.com, for reference only.
Publishing research using A17911? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.