Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

[KO Validated] APP Rabbit mAb (A17911)

KO/KDValidated

Publications (8) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] APP Rabbit mAb (A17911)

Western blot analysis of lysates from wild type (WT) and APP knockout (KO) 293T cells, using [KO Validated] APP Rabbit mAb (A17911) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - [KO Validated] APP Rabbit mAb (A17911)

Western blot analysis of various lysates using [KO Validated] APP Rabbit mAb (A17911) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - [KO Validated] APP Rabbit mAb (A17911)

Immunofluorescence analysis of HeLa cells using APP Rabbit mAb (A17911) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - [KO Validated] APP Rabbit mAb (A17911)

Confocal imaging of paraffin-embedded 5XFAD Mouse brain and Mouse brain using [KO Validated] APP Rabbit mAb (A17911, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.

ABclonal:Immunoprecipitation - [KO Validated] APP Rabbit mAb (A17911)

Immunoprecipitation analysis of 300 μg extracts from HeLa cells using 3 μg [KO Validated] APP Rabbit mAb (A17911). Western blot was performed from the immunoprecipitate using [KO Validated] APP Rabbit mAb (A17911) at a dilution of 1:1000.

You may also interested in:

Overview

Product name [KO Validated] APP Rabbit mAb
Catalog No. A17911
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0465

Background

This gene encodes a cell surface receptor and transmembrane precursor protein that is cleaved by secretases to form a number of peptides. Some of these peptides are secreted and can bind to the acetyltransferase complex APBB1/TIP60 to promote transcriptional activation, while others form the protein basis of the amyloid plaques found in the brains of patients with Alzheimer disease. In addition, two of the peptides are antimicrobial peptides, having been shown to have bacteriocidal and antifungal activities. Mutations in this gene have been implicated in autosomal dominant Alzheimer disease and cerebroarterial amyloidosis (cerebral amyloid angiopathy). Multiple transcript variants encoding several different isoforms have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 671-770 of human APP (P05067).
Sequence MDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Gene ID 351
Swiss prot P05067
Synonyms AAA; AD1; PN2; ABPP; APPI; CVAP; ABETA; PN-II; preA4; CTFgamma; alpha-sAPP; PP
Calculated MW 87kDa
Observed MW 100-140kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IF/ICC HumanMouse
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:2000
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunofluorescence    Immunoprecipitation    
Positive samples 293T, HeLa, U-87 MG, Mouse brain, Rat brain
Cellular location Membrane, Single-pass type I membrane protein, clathrin-coated pit
Customer validation

IF (Rattus norvegicus, Mus musculus)

WB (Homo sapiens, Rattus norvegicus, Mus musculus)

IHC (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] APP Rabbit mAb images

ABclonal:Western blot - [KO Validated] APP Rabbit mAb (A17911)}

Western blot - [KO Validated] APP Rabbit mAb (A17911)

Western blot analysis of lysates from wild type (WT) and APP knockout (KO) 293T cells, using [KO Validated] APP Rabbit mAb (A17911) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - [KO Validated] APP Rabbit mAb (A17911)}

Western blot - [KO Validated] APP Rabbit mAb (A17911)

Western blot analysis of various lysates using [KO Validated] APP Rabbit mAb (A17911) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Immunofluorescence - [KO Validated] APP Rabbit mAb (A17911)}

Immunofluorescence - [KO Validated] APP Rabbit mAb (A17911)

Immunofluorescence analysis of HeLa cells using APP Rabbit mAb (A17911) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - [KO Validated] APP Rabbit mAb (A17911)}

Immunofluorescence - [KO Validated] APP Rabbit mAb (A17911)

Confocal imaging of paraffin-embedded 5XFAD Mouse brain and Mouse brain using [KO Validated] APP Rabbit mAb (A17911, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.
ABclonal:Immunoprecipitation - [KO Validated] APP Rabbit mAb (A17911)}

Immunoprecipitation - [KO Validated] APP Rabbit mAb (A17911)

Immunoprecipitation analysis of 300 μg extracts from HeLa cells using 3 μg [KO Validated] APP Rabbit mAb (A17911). Western blot was performed from the immunoprecipitate using [KO Validated] APP Rabbit mAb (A17911) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A17911 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on APP. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to APP. (Distance between topics and target gene indicate popularity.) APP

* Data provided by citexs.com, for reference only.

Publishing research using A17911? Please let us know so that we can cite the reference in this datasheet.

Antibodies (8)

Proteins (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order