Product name | [KO Validated] APEX1 Rabbit pAb |
---|---|
Catalog No. | A2587 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-318 of human APEX1 (NP_542380.1). |
---|---|
Sequence | MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL |
Gene ID | 328 |
Swiss prot | P27695 |
Synonyms | APEX1; APE; APE1; APEN; APEX; APX; HAP1; REF1 |
Calculated MW | 35kDa |
Observed MW | 39kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IF 1:50 - 1:100 IP 1:50 - 1:200 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunofluorescence Immunoprecipitation |
Positive samples | HeLa, HepG2 |
Cellular location | Cytoplasm, Endoplasmic reticulum, Mitochondrion, Nucleus, Nucleus speckle, nucleolus |
Submit your question about A2587 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.