Product name | [KO Validated] ANXA5 Rabbit pAb |
---|---|
Catalog No. | A1728 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-320 of human ANXA5 (NP_001145.1). |
---|---|
Sequence | MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD |
Gene ID | 308 |
Swiss prot | P08758 |
Synonyms | ANXA5; ANX5; ENX2; HEL-S-7; PP4; RPRGL3 |
Calculated MW | 35kDa |
Observed MW | 35kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHCICCIFIPChIPChIPseqRIPFCELISAMeDIPNucleotide ArrayDB |
Recommended dilution | WB 1:500 - 1:2000 IF 1:50 - 1:200 |
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunofluorescence |
Positive samples | HepG2, HeLa, DU145, PC-3, Mouse lung |
Cellular location | |
Customer validation | (Human prostate) |
Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com
Submit your question about A1728 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.