Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

[KO Validated] AKT1 Rabbit mAb (A20799)

KO/KDValidated

Publications (9) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] AKT1 Rabbit mAb (A20799)

Western blot analysis of extracts of various cell lines, using AKT1 antibody (A20799) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Western blot - [KO Validated] AKT1 Rabbit mAb (A20799)

Western blot analysis of extracts from wild type (WT) and AKT1 knockout (KO) HeLa cells, using AKT1 antibody (A20799) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

You may also interested in:

Overview

Product name [KO Validated] AKT1 Rabbit mAb
Catalog No. A20799
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC51579

Background

This gene encodes one of the three members of the human AKT serine-threonine protein kinase family which are often referred to as protein kinase B alpha, beta, and gamma. These highly similar AKT proteins all have an N-terminal pleckstrin homology domain, a serine/threonine-specific kinase domain and a C-terminal regulatory domain. These proteins are phosphorylated by phosphoinositide 3-kinase (PI3K). AKT/PI3K forms a key component of many signalling pathways that involve the binding of membrane-bound ligands such as receptor tyrosine kinases, G-protein coupled receptors, and integrin-linked kinase. These AKT proteins therefore regulate a wide variety of cellular functions including cell proliferation, survival, metabolism, and angiogenesis in both normal and malignant cells. AKT proteins are recruited to the cell membrane by phosphatidylinositol 3, 4, 5-trisphosphate (PIP3) after phosphorylation of phosphatidylinositol 4, 5-bisphosphate (PIP2) by PI3K. Subsequent phosphorylation of both threonine residue 308 and serine residue 473 is required for full activation of the AKT1 protein encoded by this gene. Phosphorylation of additional residues also occurs, for example, in response to insulin growth factor-1 and epidermal growth factor. Protein phosphatases act as negative regulators of AKT proteins by dephosphorylating AKT or PIP3. The PI3K/AKT signalling pathway is crucial for tumor cell survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating AKT1 which then phosphorylates and inactivates components of the apoptotic machinery. AKT proteins also participate in the mammalian target of rapamycin (mTOR) signalling pathway which controls the assembly of the eukaryotic translation initiation factor 4F (eIF4E) complex and this pathway, in addition to responding to extracellular signals from growth factors and cytokines, is disregulated in many cancers. Mutations in this gene are associated with multiple types of cancer and excessive tissue growth including Proteus syndrome and Cowden syndrome 6, and breast, colorectal, and ovarian cancers. Multiple alternatively spliced transcript variants have been found for this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 381-480 of human AKT1 (NP_005154.2).
Sequence SGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
Gene ID 207
Swiss prot P31749
Synonyms AKT; PKB; RAC; PRKBA; PKB-ALPHA; RAC-ALPHA; T1
Calculated MW 56kDa
Observed MW 60kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples HeLa, MCF7, Mouse testis, Mouse brain, Mouse thymus, Rat testis
Cellular location Cell membrane, Cytoplasm, Nucleus
Customer validation

IHC (Homo sapiens)

WB (Rattus norvegicus, Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] AKT1 Rabbit mAb images

ABclonal:Western blot - [KO Validated] AKT1 Rabbit mAb (A20799)}

Western blot - [KO Validated] AKT1 Rabbit mAb (A20799)

Western blot analysis of extracts of various cell lines, using AKT1 antibody (A20799) at1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Western blot - [KO Validated] AKT1 Rabbit mAb (A20799)}

Western blot - [KO Validated] AKT1 Rabbit mAb (A20799)

Western blot analysis of extracts from wild type (WT) and AKT1 knockout (KO) HeLa cells, using AKT1 antibody (A20799) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

Inquire About This Product

Submit your question about A20799 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on AKT1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to AKT1. (Distance between topics and target gene indicate popularity.) AKT1

* Data provided by citexs.com, for reference only.

Publishing research using A20799? Please let us know so that we can cite the reference in this datasheet.

Antibodies (18)

ELISA Kits (1)

Proteins (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order