Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] AIF Rabbit pAb (A2568)

KO/KDValidated

Reviews (3) Publications (7) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] AIF Rabbit pAb (A2568)

Western blot analysis of various lysates using [KO Validated] AIF Rabbit pAb (A2568) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Western blot - [KO Validated] AIF Rabbit pAb (A2568)

Western blot analysis of lysates from wild type (WT) and AIF knockout (KO) 293T cells, using [KO Validated] AIF Rabbit pAb (A2568) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - [KO Validated] AIF Rabbit pAb (A2568)

Immunofluorescence analysis of C6 cells using [KO Validated] AIF Rabbit pAb (A2568) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - [KO Validated] AIF Rabbit pAb (A2568)

Immunofluorescence analysis of L929 cells using [KO Validated] AIF Rabbit pAb (A2568) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - [KO Validated] AIF Rabbit pAb (A2568)

Immunofluorescence analysis of paraffin-embedded mouse skeletal muscle using [KO Validated] AIF Rabbit pAb (A2568) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - [KO Validated] AIF Rabbit pAb (A2568)

Confocal immunofluorescence analysis of HeLa cells using [KO Validated] AIF Rabbit pAb (A2568) at dilution of 1:200. Blue: DAPI for nuclear staining.

Review
ABclonal: review for [KO Validated] AIF Rabbit pAb(A2568)
Review
ABclonal: review for [KO Validated] AIF Rabbit pAb(A2568)
Review
ABclonal: review for [KO Validated] AIF Rabbit pAb(A2568)

You may also interested in:

Overview

Product name [KO Validated] AIF Rabbit pAb
Catalog No. A2568
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, and it is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Mutations in this gene cause combined oxidative phosphorylation deficiency 6 (COXPD6), a severe mitochondrial encephalomyopathy, as well as Cowchock syndrome, also known as X-linked recessive Charcot-Marie-Tooth disease-4 (CMTX-4), a disorder resulting in neuropathy, and axonal and motor-sensory defects with deafness and cognitive disability. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome 10.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 334-613 of human AIF (NP_004199.1).
Sequence FPEKGNMGKILPEYLSNWTMEKVRREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEVAKLFNIHED
Gene ID 9131
Swiss prot O95831
Synonyms AIF; AUNX1; CMT2D; CMTX4; COWCK; DFNX5; NADMR; NAMSD; PDCD8; COXPD6; SEMDHL; IF
Calculated MW 67kDa
Observed MW 67kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples 293T, SW620, 22Rv1, H460, PC-3, U-937, Mouse liver, Mouse kidney, Mouse heart
Cellular location Cytoplasm, Mitochondrion inner membrane, Mitochondrion intermembrane space, Nucleus, perinuclear region
Customer validation

WB (Eoma cell, 293THomo sapiens, Homo sapiens, Dianella ensifolia, Mus musculus)

IP (293T)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] AIF Rabbit pAb images

ABclonal:Western blot - [KO Validated] AIF Rabbit pAb (A2568)}

Western blot - [KO Validated] AIF Rabbit pAb (A2568)

Western blot analysis of various lysates using [KO Validated] AIF Rabbit pAb (A2568) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
ABclonal:Western blot - [KO Validated] AIF Rabbit pAb (A2568)}

Western blot - [KO Validated] AIF Rabbit pAb (A2568)

Western blot analysis of lysates from wild type (WT) and AIF knockout (KO) 293T cells, using [KO Validated] AIF Rabbit pAb (A2568) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunofluorescence - [KO Validated] AIF Rabbit pAb (A2568)}

Immunofluorescence - [KO Validated] AIF Rabbit pAb (A2568)

Immunofluorescence analysis of C6 cells using [KO Validated] AIF Rabbit pAb (A2568) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - [KO Validated] AIF Rabbit pAb (A2568)}

Immunofluorescence - [KO Validated] AIF Rabbit pAb (A2568)

Immunofluorescence analysis of L929 cells using [KO Validated] AIF Rabbit pAb (A2568) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - [KO Validated] AIF Rabbit pAb (A2568)}

Immunofluorescence - [KO Validated] AIF Rabbit pAb (A2568)

Immunofluorescence analysis of paraffin-embedded mouse skeletal muscle using [KO Validated] AIF Rabbit pAb (A2568) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - [KO Validated] AIF Rabbit pAb (A2568)}

Immunofluorescence - [KO Validated] AIF Rabbit pAb (A2568)

Confocal immunofluorescence analysis of HeLa cells using [KO Validated] AIF Rabbit pAb (A2568) at dilution of 1:200. Blue: DAPI for nuclear staining.

Submit an review for A2568

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A2568 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on AIFM1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to AIFM1. (Distance between topics and target gene indicate popularity.) AIFM1

* Data provided by citexs.com, for reference only.

Publishing research using A2568? Please let us know so that we can cite the reference in this datasheet.

Antibodies (2)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order