Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

[KO Validated] GRK2 Rabbit pAb (A1662)

KO/KDValidated

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] GRK2 Rabbit pAb (A1662)

Western blot analysis of extracts of various cell lines, using GRK2 antibody (A1662) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.

ABclonal:Western blot - [KO Validated] GRK2 Rabbit pAb (A1662)

Western blot analysis of extracts from normal (control) and GRK2 knockout (KO) 293T cells, using GRK2 antibody (A1662) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - [KO Validated] GRK2 Rabbit pAb (A1662)

Immunohistochemistry analysis of paraffin-embedded rat brain using GRK2 Antibody (A1662) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - [KO Validated] GRK2 Rabbit pAb (A1662)

Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using GRK2 Antibody (A1662) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - [KO Validated] GRK2 Rabbit pAb (A1662)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using GRK2 Antibody (A1662) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name [KO Validated] GRK2 Rabbit pAb
Catalog No. A1662
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the G protein-coupled receptor kinase family of proteins. The encoded protein phosphorylates the beta-adrenergic receptor as well as a wide range of other substrates including non-GPCR cell surface receptors, and cytoskeletal, mitochondrial, and transcription factor proteins. Data from rodent models supports a role for this gene in embryonic development, heart function and metabolism. Elevated expression of this gene has been observed in human patients with heart failure and Alzheimer's disease.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 440-689 of human GRK2 (NP_001610.2).
Sequence LGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARKKAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL
Gene ID 156
Swiss prot P25098
Synonyms BARK1; ADRBK1; BETA-ARK1; K2
Calculated MW 80kDa
Observed MW 80kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HT-29, Mouse spleen, Mouse brain
Cellular location Cell membrane, Cytoplasm

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] GRK2 Rabbit pAb images

ABclonal:Western blot - [KO Validated] GRK2 Rabbit pAb (A1662)}

Western blot - [KO Validated] GRK2 Rabbit pAb (A1662)

Western blot analysis of extracts of various cell lines, using GRK2 antibody (A1662) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
ABclonal:Western blot - [KO Validated] GRK2 Rabbit pAb (A1662)}

Western blot - [KO Validated] GRK2 Rabbit pAb (A1662)

Western blot analysis of extracts from normal (control) and GRK2 knockout (KO) 293T cells, using GRK2 antibody (A1662) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Immunohistochemistry - [KO Validated] GRK2 Rabbit pAb (A1662)}

Immunohistochemistry - [KO Validated] GRK2 Rabbit pAb (A1662)

Immunohistochemistry analysis of paraffin-embedded rat brain using GRK2 Antibody (A1662) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KO Validated] GRK2 Rabbit pAb (A1662)}

Immunohistochemistry - [KO Validated] GRK2 Rabbit pAb (A1662)

Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using GRK2 Antibody (A1662) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - [KO Validated] GRK2 Rabbit pAb (A1662)}

Immunohistochemistry - [KO Validated] GRK2 Rabbit pAb (A1662)

Immunohistochemistry analysis of paraffin-embedded mouse kidney using GRK2 Antibody (A1662) at dilution of 1:200 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A1662 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on GRK2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to GRK2. (Distance between topics and target gene indicate popularity.) GRK2

* Data provided by citexs.com, for reference only.

Publishing research using A1662? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order