Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

[KO Validated] ACVR2A Rabbit mAb (A5237)

KO/KDValidated

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] ACVR2A Rabbit mAb (A5237)

Western blot analysis of various lysates using ACVR2A Rabbit mAb (A5237) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Western blot - [KO Validated] ACVR2A Rabbit mAb (A5237)

Western blot analysis of various lysates using ACVR2A Rabbit mAb (A5237) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Western blot - [KO Validated] ACVR2A Rabbit mAb (A5237)

Western blot analysis of lysates from wild type(WT) and ACVR2A knockout (KO) 293T cells, using [KO Validated] ACVR2A Rabbit mAb (A5237) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

You may also interested in:

Overview

Product name [KO Validated] ACVR2A Rabbit mAb
Catalog No. A5237
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC1220

Background

This gene encodes a receptor that mediates the functions of activins, which are members of the transforming growth factor-beta (TGF-beta) superfamily involved in diverse biological processes. The encoded protein is a transmembrane serine-threonine kinase receptor which mediates signaling by forming heterodimeric complexes with various combinations of type I and type II receptors and ligands in a cell-specific manner. The encoded type II receptor is primarily involved in ligand-binding and includes an extracellular ligand-binding domain, a transmembrane domain and a cytoplasmic serine-threonine kinase domain. This gene may be associated with susceptibility to preeclampsia, a pregnancy-related disease which can result in maternal and fetal morbidity and mortality. Alternative splicing results in multiple transcript variants of this gene.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ACVR2A (P27037).
Sequence MGAAAKLAFAVFLISCSSGAILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEV
Gene ID 92
Swiss prot P27037
Synonyms ACVR2; ACTRII; 2A
Calculated MW 58kDa
Observed MW 80kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
WB HumanMouseRat
Recommended dilution
  • WB 1:500 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples 293T, A-549, SW481Mouse liver, Mouse testis, Mouse brain, Rat testis
Cellular location Membrane, Single-pass type I membrane protein
Customer validation

WB (Mus musculus)

IHC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

[KO Validated] ACVR2A Rabbit mAb images

ABclonal:Western blot - [KO Validated] ACVR2A Rabbit mAb (A5237)}

Western blot - [KO Validated] ACVR2A Rabbit mAb (A5237)

Western blot analysis of various lysates using ACVR2A Rabbit mAb (A5237) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
ABclonal:Western blot - [KO Validated] ACVR2A Rabbit mAb (A5237)}

Western blot - [KO Validated] ACVR2A Rabbit mAb (A5237)

Western blot analysis of various lysates using ACVR2A Rabbit mAb (A5237) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.
ABclonal:Western blot - [KO Validated] ACVR2A Rabbit mAb (A5237)}

Western blot - [KO Validated] ACVR2A Rabbit mAb (A5237)

Western blot analysis of lysates from wild type(WT) and ACVR2A knockout (KO) 293T cells, using [KO Validated] ACVR2A Rabbit mAb (A5237) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

Inquire About This Product

Submit your question about A5237 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ACVR2A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ACVR2A. (Distance between topics and target gene indicate popularity.) ACVR2A

* Data provided by citexs.com, for reference only.

Publishing research using A5237? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

Proteins (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order