Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

KLF4 Rabbit mAb (A13673)

Publications (10) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - KLF4 Rabbit mAb (A13673)

Western blot analysis of various lysates using KLF4 Rabbit mAb (A13673) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Western blot - KLF4 Rabbit mAb (A13673)

Western blot analysis of lysates from Mouse lung, using KLF4 Rabbit mAb (A13673) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunohistochemistry - KLF4 Rabbit mAb (A13673)

Immunohistochemistry analysis of KLF4 in paraffin-embedded human colon using KLF4 Rabbit mAb (A13673) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - KLF4 Rabbit mAb (A13673)

Immunohistochemistry analysis of KLF4 in paraffin-embedded human liver cancer using KLF4 Rabbit mAb (A13673) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - KLF4 Rabbit mAb (A13673)

Immunohistochemistry analysis of KLF4 in paraffin-embedded mouse brain using KLF4 Rabbit mAb (A13673) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - KLF4 Rabbit mAb (A13673)

Immunohistochemistry analysis of KLF4 in paraffin-embedded mouse kidney using KLF4 Rabbit mAb (A13673) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - KLF4 Rabbit mAb (A13673)

Confocal imaging of U-2 OS cells using KLF4 Rabbit mAb (A13673, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

ABclonal:Immunoprecipitation - KLF4 Rabbit mAb (A13673)

Immunoprecipitation analysis of 300 μg extracts from HeLa cells using 3 μg KLF4 Rabbit mAb (A13673). Western blot was performed from the immunoprecipitate using KLF4 Rabbit mAb (A13673) at a dilution of 1:1000.

You may also interested in:

Overview

Product name KLF4 Rabbit mAb
Catalog No. A13673
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC0721

Background

This gene encodes a protein that belongs to the Kruppel family of transcription factors. The encoded zinc finger protein is required for normal development of the barrier function of skin. The encoded protein is thought to control the G1-to-S transition of the cell cycle following DNA damage by mediating the tumor suppressor gene p53. Mice lacking this gene have a normal appearance but lose weight rapidly, and die shortly after birth due to fluid evaporation resulting from compromised epidermal barrier function. Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 300-400 of human KLF4 (O43474).
Sequence PAAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQVPPLHYQGQSRGFVARAGEPCVCWPHFGTHGMMLTPPSSPL
Gene ID 9314
Swiss prot O43474
Synonyms EZF; GKLF; KLF4
Calculated MW 55kDa
Observed MW 55kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IF/ICC HumanRat
IHC-P HumanRat
WB HumanMouse
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
  • IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    Immunoprecipitation    
Positive samples A549, A-431, HeLa, Mouse lung
Cellular location Nucleus
Customer validation

IF (Mus musculus)

WB (Mus musculus, Homo sapiens, Rattus norvegicus, Homo sapiensMus musculus)

IHC (Mus musculus)

FCM (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

KLF4 Rabbit mAb images

ABclonal:Western blot - KLF4 Rabbit mAb (A13673)}

Western blot - KLF4 Rabbit mAb (A13673)

Western blot analysis of various lysates using KLF4 Rabbit mAb (A13673) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.
ABclonal:Western blot - KLF4 Rabbit mAb (A13673)}

Western blot - KLF4 Rabbit mAb (A13673)

Western blot analysis of lysates from Mouse lung, using KLF4 Rabbit mAb (A13673) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.
ABclonal:Immunohistochemistry - KLF4 Rabbit mAb (A13673)}

Immunohistochemistry - KLF4 Rabbit mAb (A13673)

Immunohistochemistry analysis of KLF4 in paraffin-embedded human colon using KLF4 Rabbit mAb (A13673) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - KLF4 Rabbit mAb (A13673)}

Immunohistochemistry - KLF4 Rabbit mAb (A13673)

Immunohistochemistry analysis of KLF4 in paraffin-embedded human liver cancer using KLF4 Rabbit mAb (A13673) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - KLF4 Rabbit mAb (A13673)}

Immunohistochemistry - KLF4 Rabbit mAb (A13673)

Immunohistochemistry analysis of KLF4 in paraffin-embedded mouse brain using KLF4 Rabbit mAb (A13673) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - KLF4 Rabbit mAb (A13673)}

Immunohistochemistry - KLF4 Rabbit mAb (A13673)

Immunohistochemistry analysis of KLF4 in paraffin-embedded mouse kidney using KLF4 Rabbit mAb (A13673) at dilution of 1:200 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - KLF4 Rabbit mAb (A13673)}

Immunofluorescence - KLF4 Rabbit mAb (A13673)

Confocal imaging of U-2 OS cells using KLF4 Rabbit mAb (A13673, dilution 1:100)(Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.
ABclonal:Immunoprecipitation - KLF4 Rabbit mAb (A13673)}

Immunoprecipitation - KLF4 Rabbit mAb (A13673)

Immunoprecipitation analysis of 300 μg extracts from HeLa cells using 3 μg KLF4 Rabbit mAb (A13673). Western blot was performed from the immunoprecipitate using KLF4 Rabbit mAb (A13673) at a dilution of 1:1000.

Inquire About This Product

Submit your question about A13673 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KLF4. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KLF4. (Distance between topics and target gene indicate popularity.) KLF4

* Data provided by citexs.com, for reference only.

Publishing research using A13673? Please let us know so that we can cite the reference in this datasheet.

Antibodies (3)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order