Product Type > Antibodies > Primary Antibodies > Monoclonal Antibodies

KIF4A Rabbit mAb (A9080)

Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - KIF4A Rabbit mAb (A9080)

Western blot analysis of extracts of various cell lines, using KIF4A antibody (A9080) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - KIF4A Rabbit mAb (A9080)

Immunohistochemistry analysis of paraffin-embedded rat testis using KIF4A Rabbit mAb (A9080) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - KIF4A Rabbit mAb (A9080)

Immunohistochemistry analysis of paraffin-embedded human colon using KIF4A Rabbit mAb (A9080) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - KIF4A Rabbit mAb (A9080)

Immunohistochemistry analysis of paraffin-embedded mouse testis using KIF4A Rabbit mAb (A9080) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name KIF4A Rabbit mAb
Catalog No. A9080
Host species Rabbit
Purification method Affinity purification
Isotype IgG
CloneNo. ARC1405

Background

This gene encodes a member of the kinesin 4 subfamily of kinesin related proteins. The encoded protein is an ATP dependent microtubule-based motor protein that is involved in the intracellular transport of membranous organelles. This protein also associates with condensed chromosome arms and may be involved in maintaining chromosome integrity during mitosis. This protein may also be involved in the organization of the central spindle prior to cytokinesis. A pseudogene of this gene is found on chromosome X.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human KIF4A (O95239).
Sequence MKEEVKGIPVRVALRCRPLVPKEISEGCQMCLSFVPGEPQVVVGTDKSFTYDFVFDPSTEQEEVFNTAVAPLIKGVFKGYNATVLAYGQTGSGKTYSMGG
Gene ID 24137
Swiss prot O95239
Synonyms KIF4; KIF4G1; MRX100; XLID100; KIF4A
Calculated MW 140kDa
Observed MW 160kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications Testing results
IHC-P HumanRat
WB Human
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HeLa, A549
Cellular location Axon cytoplasm, Cytoplasm, Cytosol, Nuclear matrix, Nucleoplasm, Spindle microtubule

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

KIF4A Rabbit mAb images

ABclonal:Western blot - KIF4A Rabbit mAb (A9080)}

Western blot - KIF4A Rabbit mAb (A9080)

Western blot analysis of extracts of various cell lines, using KIF4A antibody (A9080) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
ABclonal:Immunohistochemistry - KIF4A Rabbit mAb (A9080)}

Immunohistochemistry - KIF4A Rabbit mAb (A9080)

Immunohistochemistry analysis of paraffin-embedded rat testis using KIF4A Rabbit mAb (A9080) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - KIF4A Rabbit mAb (A9080)}

Immunohistochemistry - KIF4A Rabbit mAb (A9080)

Immunohistochemistry analysis of paraffin-embedded human colon using KIF4A Rabbit mAb (A9080) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - KIF4A Rabbit mAb (A9080)}

Immunohistochemistry - KIF4A Rabbit mAb (A9080)

Immunohistochemistry analysis of paraffin-embedded mouse testis using KIF4A Rabbit mAb (A9080) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A9080 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KIF4A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KIF4A. (Distance between topics and target gene indicate popularity.) KIF4A

* Data provided by citexs.com, for reference only.

Publishing research using A9080? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order