Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

KDM3B Rabbit pAb (A2312)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - KDM3B Rabbit pAb (A2312)

Western blot analysis of Hela, using KDM3B Rabbit pAb (A2312) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - KDM3B Rabbit pAb (A2312)

Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using KDM3B Rabbit pAb (A2312) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name KDM3B Rabbit pAb
Catalog No. A2312
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Predicted to enable chromatin DNA binding activity; histone H3-methyl-lysine-9 demethylase activity; and transcription coregulator activity. Predicted to be involved in histone H3-K9 demethylation and regulation of transcription by RNA polymerase II. Located in nucleoplasm. Biomarker of acute lymphoblastic leukemia; breast cancer; colorectal cancer; and lung non-small cell carcinoma.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 400-600 of human KDM3B (NP_057688.2).
Sequence GAENKEAGKTLEQVGQGIVASAAVVTTASSTPNTVRISDTGLAAGTVPEKQKGSRSQASGENSRNSILASSGFGAPLPSSSQPLTFGSGRSQSNGVLATENKPLGFSFGCSSAQEAQKDTDLSKNLFFQCMSQTLPTSNYFTTVSESLADDSSSRDSFKQSLESLSSGLCKGRSVLGTDTKPGSKAGSSVDRKVPAESMPT
Gene ID 51780
Swiss prot Q7LBC6
Synonyms 5qNCA; DIJOS; NET22; C5orf7; JMJD1B; KDM3B
Calculated MW 192kDa
Observed MW 225kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples HeLa
Cellular location Nucleus
Customer validation

WB (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

KDM3B Rabbit pAb images

ABclonal:Western blot - KDM3B Rabbit pAb (A2312)}

Western blot - KDM3B Rabbit pAb (A2312)

Western blot analysis of Hela, using KDM3B Rabbit pAb (A2312) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - KDM3B Rabbit pAb (A2312)}

Immunohistochemistry - KDM3B Rabbit pAb (A2312)

Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using KDM3B Rabbit pAb (A2312) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A2312 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KDM3B. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KDM3B. (Distance between topics and target gene indicate popularity.) KDM3B

* Data provided by citexs.com, for reference only.

Publishing research using A2312? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order