Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

KDM3A Rabbit pAb (A11960)

Publications (2) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - KDM3A Rabbit pAb (A11960)

Western blot analysis of various lysates, using KDM3A Rabbit pAb (A11960) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - KDM3A Rabbit pAb (A11960)

Immunohistochemistry analysis of paraffin-embedded human liver cancer using KDM3A Rabbit pAb (A11960) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - KDM3A Rabbit pAb (A11960)

Immunofluorescence analysis of U2OS cells using KDM3A Rabbit pAb (A11960) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name KDM3A Rabbit pAb
Catalog No. A11960
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables androgen receptor binding activity; histone H3-methyl-lysine-9 demethylase activity; and iron ion binding activity. Involved in several processes, including androgen receptor signaling pathway; formaldehyde biosynthetic process; and histone H3-K9 demethylation. Located in nucleoplasm. Implicated in cervical cancer and colon cancer. Biomarker of Ewing sarcoma; hepatocellular carcinoma; nasopharynx carcinoma; and prostate cancer.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 975-1283 of human KDM3A (NP_060903.2).
Sequence PVMVSGVHHKLNSELWKPESFRKEFGEQEVDLVNCRTNEIITGATVGDFWDGFEDVPNRLKNEKEPMVLKLKDWPPGEDFRDMMPSRFDDLMANIPLPEYTRRDGKLNLASRLPNYFVRPDLGPKMYNAYGLITPEDRKYGTTNLHLDVSDAANVMVYVGIPKGQCEQEEEVLKTIQDGDSDELTIKRFIEGKEKPGALWHIYAAKDTEKIREFLKKVSEEQGQENPADHDPIHDQSWYLDRSLRKRLHQEYGVQGWAIVQFLGDVVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFWLTQEFRYL
Gene ID 55818
Swiss prot Q9Y4C1
Synonyms TSGA; JMJD1; JHDM2A; JHMD2A; JMJD1A; KDM3A
Calculated MW 147kDa
Observed MW 147kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples 293F, HAP1
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Homo sapiens, Mus musculus)

IHC (Homo sapiens)

IF (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

KDM3A Rabbit pAb images

ABclonal:Western blot - KDM3A Rabbit pAb (A11960)}

Western blot - KDM3A Rabbit pAb (A11960)

Western blot analysis of various lysates, using KDM3A Rabbit pAb (A11960) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - KDM3A Rabbit pAb (A11960)}

Immunohistochemistry - KDM3A Rabbit pAb (A11960)

Immunohistochemistry analysis of paraffin-embedded human liver cancer using KDM3A Rabbit pAb (A11960) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - KDM3A Rabbit pAb (A11960)}

Immunofluorescence - KDM3A Rabbit pAb (A11960)

Immunofluorescence analysis of U2OS cells using KDM3A Rabbit pAb (A11960) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A11960 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KDM3A. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KDM3A. (Distance between topics and target gene indicate popularity.) KDM3A

* Data provided by citexs.com, for reference only.

Publishing research using A11960? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order