Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

KCNMB1 Rabbit pAb (A10224)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human

ABclonal:Western blot - KCNMB1 Rabbit pAb (A10224)

Western blot analysis of extracts of various cell lines, using KCNMB1 antibody (A10224) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

You may also interested in:

Overview

Product name KCNMB1 Rabbit pAb
Catalog No. A10224
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

MaxiK channels are large conductance, voltage and calcium-sensitive potassium channels which are fundamental to the control of smooth muscle tone and neuronal excitability. MaxiK channels can be formed by 2 subunits: the pore-forming alpha subunit and the product of this gene, the modulatory beta subunit. Intracellular calcium regulates the physical association between the alpha and beta subunits.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 30-102 of human KCNMB1 (NP_004128.1).
Sequence TYYILVTTVLPLYQKSVWTQESKCHLIETNIRDQEELKGKKVPQYPCLWVNVSAAGRWAVLYHTEDTRDQNQQ
Gene ID 3779
Swiss prot Q16558
Synonyms hbeta1; BKbeta1; SLO-BETA; hslo-beta; K(VCA)beta; slo-beta-1; k(VCA)beta-1; KCNMB1
Calculated MW 22kDa
Observed MW 18kDa

Applications

Reactivity Human
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:200 - 1:2000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples U-87MG, THP-1, MCF7
Cellular location Membrane, Multi-pass membrane protein

Research Area

KCNMB1 Rabbit pAb images

ABclonal:Western blot - KCNMB1 Rabbit pAb (A10224)}

Western blot - KCNMB1 Rabbit pAb (A10224)

Western blot analysis of extracts of various cell lines, using KCNMB1 antibody (A10224) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Inquire About This Product

Submit your question about A10224 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KCNMB1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KCNMB1. (Distance between topics and target gene indicate popularity.) KCNMB1

* Data provided by citexs.com, for reference only.

Publishing research using A10224? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order