Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

KCND3 Rabbit pAb (A6927)

Publications (3) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - KCND3 Rabbit pAb (A6927)

Western blot analysis of extracts of various cell lines, using KCND3 antibody (A6927) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - KCND3 Rabbit pAb (A6927)

Immunohistochemistry analysis of paraffin-embedded rat heart using KCND3 Rabbit pAb (A6927) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name KCND3 Rabbit pAb
Catalog No. A6927
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shal-related subfamily, members of which form voltage-activated A-type potassium ion channels and are prominent in the repolarization phase of the action potential. This member includes two isoforms with different sizes, which are encoded by alternatively spliced transcript variants of this gene.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 521-655 of human KCND3 (NP_004971.2).
Sequence MESSMQNYPSTRSPSLSSHPGLTTTCCSRRSKKTTHLPNSNLPATRLRSMQELSTIHIQGSEQPSLTTSRSSLNLKADDGLRPNCKTSQITTAIISIPTPPALTPEGESRPPPASPGPNTNIPSIASNVVKVSAL
Gene ID 3752
Swiss prot Q9UK17
Synonyms KV4.3; SCA19; SCA22; BRGDA9; KCND3L; KCND3S; KSHIVB; KCND3
Calculated MW 73kDa
Observed MW 73kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:100 - 1:500
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples A-549, SH-SY5Y, Mouse heart, Rat heart
Cellular location Cell membrane, Cell projection, Membrane, Multi-pass membrane protein, dendrite, sarcolemma
Customer validation

WB (Mus musculus, Rattus norvegicus)

IF (Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

KCND3 Rabbit pAb images

ABclonal:Western blot - KCND3 Rabbit pAb (A6927)}

Western blot - KCND3 Rabbit pAb (A6927)

Western blot analysis of extracts of various cell lines, using KCND3 antibody (A6927) at 1:500 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - KCND3 Rabbit pAb (A6927)}

Immunohistochemistry - KCND3 Rabbit pAb (A6927)

Immunohistochemistry analysis of paraffin-embedded rat heart using KCND3 Rabbit pAb (A6927) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A6927 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KCND3. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KCND3. (Distance between topics and target gene indicate popularity.) KCND3

* Data provided by citexs.com, for reference only.

Publishing research using A6927? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order