Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

KANK2 Rabbit pAb (A15420)

Publication (1) Datasheet COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - KANK2 Rabbit pAb (A15420)

Western blot analysis of various lysates using KANK2 Rabbit pAb (A15420) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

ABclonal:Immunohistochemistry - KANK2 Rabbit pAb (A15420)

Immunohistochemistry analysis of KANK2 in paraffin-embedded rat ovary using KANK2 Rabbit pAb (A15420) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - KANK2 Rabbit pAb (A15420)

Immunohistochemistry analysis of KANK2 in paraffin-embedded rat pancreas using KANK2 Rabbit pAb (A15420) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

You may also interested in:

Overview

Product name KANK2 Rabbit pAb
Catalog No. A15420
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

This gene encodes a member of the KN motif and ankyrin repeat domains (KANK) family of proteins, which play a role in cytoskeletal formation by regulating actin polymerization. The encoded protein functions in the sequestration of steroid receptor coactivators and possibly other proteins. Mutations in this gene are associated with impaired kidney podocyte function and nephrotic syndrome, and keratoderma and woolly hair.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human KANK2 (NP_001129663.1).
Sequence MAQVLHVPAPFPGTPGPASPPAFPAKDPDPPYSVETPYGYRLDLDFLKYVDDIEKGHTLRRVAVQRRPRLSSLPRGPGSWWTSTESLCSNASGDSRHSAYSYCGRGFYPQYGALETRGGFNPRVERTLLDARRRLEDQAATPTGLGSLTPSAAGSTASLVGVGLPPPTPRSSGLSTPVPPSAGHLAHVREQMAGALRKLRQLEEQVKLIPVLQVKLSVLQEEKRQLTVQLKSQKFLGHPTAGRGRSELCLDLPDPPEDPVALETRSVGTWVRERDLGMPDGEAALAAKVAVLETQLKKAL
Gene ID 25959
Swiss prot Q63ZY3
Synonyms SIP; MXRA3; PPKWH; NPHS16; ANKRD25; KANK2
Calculated MW 91kDa
Observed MW 100kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:200 - 1:2000
  • IHC-P 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    
Positive samples Mouse skeletal muscle, Mouse heart, Mouse kidney
Cellular location Cytoplasm, Mitochondrion
Customer validation

WB (Homo sapiens)

IF (Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

KANK2 Rabbit pAb images

ABclonal:Western blot - KANK2 Rabbit pAb (A15420)}

Western blot - KANK2 Rabbit pAb (A15420)

Western blot analysis of various lysates using KANK2 Rabbit pAb (A15420) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.
ABclonal:Immunohistochemistry - KANK2 Rabbit pAb (A15420)}

Immunohistochemistry - KANK2 Rabbit pAb (A15420)

Immunohistochemistry analysis of KANK2 in paraffin-embedded rat ovary using KANK2 Rabbit pAb (A15420) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - KANK2 Rabbit pAb (A15420)}

Immunohistochemistry - KANK2 Rabbit pAb (A15420)

Immunohistochemistry analysis of KANK2 in paraffin-embedded rat pancreas using KANK2 Rabbit pAb (A15420) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Inquire About This Product

Submit your question about A15420 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on KANK2. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to KANK2. (Distance between topics and target gene indicate popularity.) KANK2

* Data provided by citexs.com, for reference only.

Publishing research using A15420? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order