Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

JNK1 Rabbit pAb (A0288)

Review (1) Publications (48) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Human, Mouse, Rat

ABclonal:Western blot - JNK1 Rabbit pAb (A0288)

Western blot analysis of extracts of SH-SY5Y cells, using JNK1 antibody (A0288) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Western blot - JNK1 Rabbit pAb (A0288)

Western blot analysis of extracts of various cell lines, using JNK1 antibody (A0288) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunohistochemistry - JNK1 Rabbit pAb (A0288)

Immunohistochemistry analysis of paraffin-embedded rat pancreas using JNK1 Rabbit pAb (A0288) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunohistochemistry - JNK1 Rabbit pAb (A0288)

Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using JNK1 Rabbit pAb (A0288) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - JNK1 Rabbit pAb (A0288)

Immunofluorescence analysis of HeLa cells using JNK1 antibody (A0288) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Review
ABclonal: review for JNK1 Rabbit pAb(A0288)

You may also interested in:

Overview

Product name JNK1 Rabbit pAb
Catalog No. A0288
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various cell stimuli, and targets specific transcription factors, and thus mediates immediate-early gene expression in response to cell stimuli. The activation of this kinase by tumor-necrosis factor alpha (TNF-alpha) is found to be required for TNF-alpha induced apoptosis. This kinase is also involved in UV radiation induced apoptosis, which is thought to be related to cytochrom c-mediated cell death pathway. Studies of the mouse counterpart of this gene suggested that this kinase play a key role in T cell proliferation, apoptosis and differentiation. Several alternatively spliced transcript variants encoding distinct isoforms have been reported.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 245-345 of human JNK1 (NP_620635.1).
Sequence CPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDER
Gene ID 5599
Swiss prot P45983
Synonyms JNK; JNK1; PRKM8; SAPK1; JNK-46; JNK1A2; SAPK1c; JNK21B1/2
Calculated MW 48kDa
Observed MW 44kDa

Applications

Reactivity Human, Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples SH-SY5Y, Mouse kidney, Rat heart
Cellular location Cytoplasm, Nucleus
Customer validation

WB (Mouse heart tissueRattus norvegicus, Homo sapiens, Mus musculus, Rattus norvegicus, Bos taurus, Chlorocebus aethiops, Gallus gallus)

IF (Mus musculus, Ctenopharyngodon idella)

qRT-PCR (Homo sapiens)

IHC (Mus musculus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

JNK1 Rabbit pAb images

ABclonal:Western blot - JNK1 Rabbit pAb (A0288)}

Western blot - JNK1 Rabbit pAb (A0288)

Western blot analysis of extracts of SH-SY5Y cells, using JNK1 antibody (A0288) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Western blot - JNK1 Rabbit pAb (A0288)}

Western blot - JNK1 Rabbit pAb (A0288)

Western blot analysis of extracts of various cell lines, using JNK1 antibody (A0288) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.
ABclonal:Immunohistochemistry - JNK1 Rabbit pAb (A0288)}

Immunohistochemistry - JNK1 Rabbit pAb (A0288)

Immunohistochemistry analysis of paraffin-embedded rat pancreas using JNK1 Rabbit pAb (A0288) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunohistochemistry - JNK1 Rabbit pAb (A0288)}

Immunohistochemistry - JNK1 Rabbit pAb (A0288)

Immunohistochemistry analysis of paraffin-embedded human thyroid cancer using JNK1 Rabbit pAb (A0288) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - JNK1 Rabbit pAb (A0288)}

Immunofluorescence - JNK1 Rabbit pAb (A0288)

Immunofluorescence analysis of HeLa cells using JNK1 antibody (A0288) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Submit an review for A0288

Please submit reviews to your technical sales specialist directly. Alternatively, email us at service@abclonal.com

Reviews List

Inquire About This Product

Submit your question about A0288 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on MAPK8. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to MAPK8. (Distance between topics and target gene indicate popularity.) MAPK8

* Data provided by citexs.com, for reference only.

Publishing research using A0288? Please let us know so that we can cite the reference in this datasheet.

Antibodies (4)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order