Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

JAG1 Rabbit pAb (A12754)

Datasheet SDS

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse

ABclonal:Western blot - JAG1 Rabbit pAb (A12754)

Western blot analysis of extracts of Mouse brain, using JAG1 antibody (A12754) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

You may also interested in:

Overview

Product name JAG1 Rabbit pAb
Catalog No. A12754
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

The jagged 1 protein encoded by JAG1 is the human homolog of the Drosophilia jagged protein. Human jagged 1 is the ligand for the receptor notch 1, the latter is involved in signaling processes. Mutations that alter the jagged 1 protein cause Alagille syndrome. Jagged 1 signalling through notch 1 has also been shown to play a role in hematopoiesis.

Immunogen information

Immunogen A synthetic peptide corresponding to a sequence within amino acids 34-180 of human JAG1 (NP_000205.1).
Sequence QFELEILSMQNVNGELQNGNCCGGARNPGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRIVLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFE
Gene ID 182
Swiss prot P78504
Synonyms AGS; AHD; AWS; HJ1; AGS1; DCHE; CD339; JAGL1; CMT2HH; JAG1
Calculated MW 134kDa
Observed MW 180kDa

Applications

Reactivity Mouse
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:1000
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Application key Western blotting    
Positive samples Mouse brain
Cellular location Membrane, Single-pass type I membrane protein

Research Area

JAG1 Rabbit pAb images

ABclonal:Western blot - JAG1 Rabbit pAb (A12754)}

Western blot - JAG1 Rabbit pAb (A12754)

Western blot analysis of extracts of Mouse brain, using JAG1 antibody (A12754) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.

Inquire About This Product

Submit your question about A12754 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on JAG1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to JAG1. (Distance between topics and target gene indicate popularity.) JAG1

* Data provided by citexs.com, for reference only.

Publishing research using A12754? Please let us know so that we can cite the reference in this datasheet.

Antibodies (1)

Proteins (1)

ELISA Kits (1)

Secondary Antibodies (23)

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order