Products > Catalog Antibodies > Polyclonal Antibodies

Insulin Rabbit pAb (A2090)

Tested applications:WB IHC ICC IF IP ChIP ChIP-seq RIP FC ELISA MeDIP Nucleotide Array DB FACS CoIPReactivity:Human, Mouse, Rat

Western blot analysis of extracts of Rat pancreas, using Insulin antibody (A2090) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.

ABclonal:Immunohistochemistry - Insulin Rabbit pAb (A2090)

Immunohistochemistry of paraffin-embedded rat pancreatic islet using Insulin Rabbit pAb (A2090) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - Insulin Rabbit pAb (A2090)

Immunofluorescence analysis of Rat pancreas using Insulin Rabbit pAb (A2090) at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of Mouse pancreatic islet using Insulin Rabbit pAb (A2090) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	Insulin Rabbit pAb
Catalog No.	A2090
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

After removal of the precursor signal peptide, proinsulin is post-translationally cleaved into three peptides: the B chain and A chain peptides, which are covalently linked via two disulfide bonds to form insulin, and C-peptide. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. A multitude of mutant alleles with phenotypic effects have been identified. There is a read-through gene, INS-IGF2, which overlaps with this gene at the 5' region and with the IGF2 gene at the 3' region. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 25-110 of human INS (NP_000198.1).
Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
Gene ID	3630
Swiss prot	P01308
Synonyms	IDDM; IDDM1; IDDM2; ILPR; IRDN; MODY10; INS; Insulin; insulin
Calculated MW	11kDa/21kDa
Observed MW	10KDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC ICC IF IP ChIP ChIP-seq RIP FC ELISA MeDIP Nucleotide Array DB FACS CoIP
Recommended dilution	WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Rat pancreas
Cellular location	Secreted
Customer validation	IHC(Mus musculus, Homo sapiens) IF(Mus musculus) WB(Mus musculus)