Tested applications:WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIPReactivity:Human, Mouse, Rat
Product name | Insulin Rabbit pAb |
---|---|
Catalog No. | A2090 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-110 of human INS (NP_000198.1). |
---|---|
Sequence | FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN |
Gene ID | 3630 |
Swiss prot | P01308 |
Synonyms | IDDM; IDDM1; IDDM2; ILPR; IRDN; MODY10; INS; Insulin; insulin |
Calculated MW | 11kDa/21kDa |
Observed MW | 10KDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHCICCIFIPChIPChIP-seqRIPFCELISAMeDIPNucleotide ArrayDBFACSCoIP |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Rat pancreas |
Cellular location | Secreted |
Customer validation | IHC(Mus musculus, Homo sapiens) IF(Mus musculus) WB(Mus musculus) |
Submit your question about A2090 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Publishing research using A2090? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.