Publications (8) Datasheet SDS COA
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPFCMCUT&TagmeRIPInhibition
Reactivity:Human, Mouse, Rat
Product name | Insulin Rabbit pAb |
---|---|
Catalog No. | A2090 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 25-110 of human INS (NP_000198.1). |
---|---|
Sequence | FVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN |
Gene ID | 3630 |
Swiss prot | P01308 |
Synonyms | IDDM; ILPR; IRDN; IDDM1; IDDM2; PNDM4; MODY10 |
Calculated MW | 12kDa |
Observed MW | 6kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPFCMCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Application key | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | Mouse pancreas, Rat pancreas |
Cellular location | Secreted |
Customer validation | IHC(Mus musculus, Homo sapiens) IF(Mus musculus, Homo sapiens) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
Submit your question about A2090 below and we will get back to you within one business day.
Alternatively, call us at 888.754.5670.
Based on existing publications, the following genes are closely related to research on INS. (Numbers indicate number of published articles where both targets appear.)
Based on existing publications, the following research topics are related to INS. (Distance between topics and target gene indicate popularity.) INS
* Data provided by citexs.com, for reference only.
Publishing research using A2090? Please let us know so that we can cite the reference in this datasheet.
* For research use only. Not for therapeutic or diagnostic purposes.