Product Type > Antibodies > Primary Antibodies > Polyclonal Antibodies

ITLN1 Rabbit pAb (A7234)

Publication (1) Datasheet SDS COA

Tested applications: WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition

Reactivity:Mouse, Rat

ABclonal:Western blot - ITLN1 Rabbit pAb (A7234)

Western blot analysis of extracts of various cell lines, using ITLN1 antibody (A7234) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - ITLN1 Rabbit pAb (A7234)

Immunohistochemistry analysis of paraffin-embedded mouse intestin using ITLN1 Rabbit pAb (A7234) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

ABclonal:Immunofluorescence - ITLN1 Rabbit pAb (A7234)

Immunofluorescence analysis of rat intestine using ITLN1 Rabbit pAb (A7234) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

ABclonal:Immunofluorescence - ITLN1 Rabbit pAb (A7234)

Immunofluorescence analysis of mouse colon using ITLN1 Rabbit pAb (A7234) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

You may also interested in:

Overview

Product name ITLN1 Rabbit pAb
Catalog No. A7234
Host species Rabbit
Purification method Affinity purification
Isotype IgG

Background

Enables calcium ion binding activity; identical protein binding activity; and oligosaccharide binding activity. Involved in positive regulation of glucose import; positive regulation of protein phosphorylation; and protein homotrimerization. Located in extracellular exosome. Part of receptor complex.

Immunogen information

Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-313 of human ITLN1 (NP_060095.2).
Sequence TDEANTYFKEWTCSSSPSLPRSCKEIKDECPSAFDGLYFLRTENGVIYQTFCDMTSGGGGWTLVASVHENDMRGKCTVGDRWSSQQGSKAVYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQAKDLGIWHVPNKSPMQHWRNSSLLRYRTDTGFLQTLGHNLFGIYQKYPVKYGEGKCWTDNGPVIPVVYDFGDAQKTASYYSPYGQREFTAGFVQFRVFNNERAANALCAGMRVTGCNTEHHCIGGGGYFPEASPQQCGDFSGFDWSGYGTHVGYSSSREITEAAVLLFYR
Gene ID 55600
Swiss prot Q8WWA0
Synonyms HL1; LFR; HL-1; INTL; ITLN; hIntL; omentin; ITLN1
Calculated MW 36kDa
Observed MW 37kDa

Applications

Reactivity Mouse, Rat
Tested applications WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra) ELISA MeDIP Nucleotide Array DB FACS CoIP FCM CUT&Tag meRIP Inhibition
Recommended dilution
  • WB 1:500 - 1:2000
  • IHC-P 1:50 - 1:200
  • IF/ICC 1:50 - 1:200
Storage buffer Store at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application key Western blotting    Immunohistochemistry    Immunofluorescence    
Positive samples Mouse heart, Rat intestine
Cellular location Cell membrane, GPI-anchor, Lipid-anchor, Secreted
Customer validation

IHC (Homo sapiens, Rattus norvegicus)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

ITLN1 Rabbit pAb images

ABclonal:Western blot - ITLN1 Rabbit pAb (A7234)}

Western blot - ITLN1 Rabbit pAb (A7234)

Western blot analysis of extracts of various cell lines, using ITLN1 antibody (A7234) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
ABclonal:Immunohistochemistry - ITLN1 Rabbit pAb (A7234)}

Immunohistochemistry - ITLN1 Rabbit pAb (A7234)

Immunohistochemistry analysis of paraffin-embedded mouse intestin using ITLN1 Rabbit pAb (A7234) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
ABclonal:Immunofluorescence - ITLN1 Rabbit pAb (A7234)}

Immunofluorescence - ITLN1 Rabbit pAb (A7234)

Immunofluorescence analysis of rat intestine using ITLN1 Rabbit pAb (A7234) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
ABclonal:Immunofluorescence - ITLN1 Rabbit pAb (A7234)}

Immunofluorescence - ITLN1 Rabbit pAb (A7234)

Immunofluorescence analysis of mouse colon using ITLN1 Rabbit pAb (A7234) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Inquire About This Product

Submit your question about A7234 below and we will get back to you within one business day.

Alternatively, call us at 888.754.5670.

Related Targets

Based on existing publications, the following genes are closely related to research on ITLN1. (Numbers indicate number of published articles where both targets appear.)

1/

Related Research Area

Based on existing publications, the following research topics are related to ITLN1. (Distance between topics and target gene indicate popularity.) ITLN1

* Data provided by citexs.com, for reference only.

Publishing research using A7234? Please let us know so that we can cite the reference in this datasheet.

* For research use only. Not for therapeutic or diagnostic purposes.

Select size and quantity
Contact us to order